KEGG   Janthinobacterium sp. LM6: BZG29_27030Help
Entry
BZG29_27030       CDS       T04756                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:jal00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BZG29_27030
Enzymes [BR:jal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BZG29_27030
Transporters [BR:jal02000]
 Other Transporters
  Pores ion channels [TC:1]
   BZG29_27030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AQR71573
UniProt: A0A1S6FDI3
LinkDB All DBs
Position
complement(6144987..6145658)
Genome map
AA seq 223 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELGLDYEVKRYQRDPKTMLAPASLKAVHPLGKSPVITDGA
NTIAESGAIIDYLVERYGNGRLIPAAGTPDKLRWTYWLHFAEGSAMPPLLMKLVFDKVEA
SPMPFFVKPIARGIAGKVKSSFILPNINSQLAYMEAELEQTKWFAGNEFTAADIQMSFPL
EAAAMRGGLDERLPKLTAFLQRIHARPAYQRALERGGPYDFAK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccatctgaacaactcgcgctcgcagcgcgtgctctggctgctcgag
gaattgggcctcgactatgaggtcaagcgctaccagcgcgacccgaagaccatgctggcg
cccgcttcgctgaaggccgtgcatccgctgggcaagtcgcccgtgatcacggatggcgcc
aacaccatcgccgaatcgggcgccatcatcgactacctggtcgagcgctacggcaatggc
cgcttgataccggcggcgggcacgcccgacaagctgcgctggacctactggctgcatttc
gcggaaggctctgccatgccgccgctgctgatgaagctggtgttcgacaaggtcgaagcg
tcgccgatgccgtttttcgtcaaaccgattgcgcgcggcatcgccggcaaggtcaagagc
agcttcatcctgcccaatatcaacagccagctggcctacatggaagcggaactggaacaa
accaaatggtttgccggcaatgaattcacggcggccgacatccagatgagctttccgctg
gaagcggcggccatgcgcggcggactcgacgagcgcctgccgaagctgacggccttcctg
cagcgcatccacgcgcggcccgcgtatcaacgtgccctggagcgtggcggcccctacgat
ttcgccaaatga

DBGET integrated database retrieval system