KEGG   Jannaschia sp. CCS1: Jann_0408Help
Entry
Jann_0408         CDS       T00330                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Jann_0408
Enzymes [BR:jan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Jann_0408
Transporters [BR:jan02000]
 Other Transporters
  Pores ion channels [TC:1]
   Jann_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Tom37 GST_C_3 GST_N_4 GST_C_5 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ABD53325
UniProt: Q28VD7
LinkDB All DBs
Position
complement(410880..411482)
Genome map
AA seq 200 aa AA seqDB search
MSEYVVFGGARSRAMRVLWMLEELGLDYAVVPTLPRSEDVRALNPTGKIPVLVEDGVAIS
DSVAIMTYLADKHGRLTAPAGTIARAQQDAFVQAVNDEIDAVLWAAARHSFILPEEQRVA
GVKDSLRWEFARNEDAIADRMSADGPFVMGEEMCLADILLSHCVGWAGSAKFDARNDRLL
AHNAMMRARPAFKRALAAGT
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatatgtggtgtttggcggcgcacgatcccgcgcgatgcgagtgttatggatg
ctggaggagttggggctggattacgccgtcgtgcccaccctgccgaggtccgaggatgtc
cgcgcgctcaacccaacaggcaagatcccggtgctggtggaagatggcgtcgcgatctct
gattcggtcgcgatcatgacgtatctggcggacaagcatggtcgcctgaccgcccctgcg
ggcacaatcgcacgcgcgcagcaggacgcgttcgtacaagccgtcaatgatgagatcgac
gctgtgctctgggcggcggcgcgccacagttttatcctgccggaggagcagcgcgtggcc
ggtgtgaaagactcgctgcggtgggagttcgcccgcaatgaagacgcgattgccgatcga
atgtccgccgatgggccgttcgtcatgggcgaggagatgtgtcttgccgatatccttctg
tcccattgcgtgggatgggcgggcagcgcgaagttcgatgcccgcaacgaccggttgttg
gcacacaacgcaatgatgcgcgcccggcccgcgttcaaacgggctttggcggcgggcacc
taa

DBGET integrated database retrieval system