KEGG   Jannaschia sp. CCS1: Jann_2108Help
Entry
Jann_2108         CDS       T00330                                 

Definition
(GenBank) Xylose isomerase-like protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00040  Pentose and glucuronate interconversions
jan00051  Fructose and mannose metabolism
jan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Jann_2108
   00051 Fructose and mannose metabolism
    Jann_2108
Enzymes [BR:jan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Jann_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABD55025
UniProt: Q28QI7
LinkDB All DBs
Position
2116526..2117497
Genome map
AA seq 323 aa AA seqDB search
MSRPNRPRYAARLNAFKQLTPGSDVRDWIAAAGQVGGLGAADLNFPDHFAVYDADQMGNF
LGEAALTLNGIAMRYYTDPGFKLGAFTHPDAAVRQAALDVTKQGIDTCARMGGKTVTLWM
GQDGFDYAFQMDYGLAWDRTVAAIADICAHDPNIDIAIEYKPNEPRAFALMPDIGTTLLA
CREVGAVNLGVTLDFAHVLYADEMPAHSAALIGRHSRMIGLHLNDGYGKRDDGLMVGSVH
AIQTVELLVAMLRMGQTDVIYFDTFPDMGGLNPIEEARTNVAVTDRLMAVAESLMEDPAL
AQAIDRQDAAASHRIVARALYGS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtccaaatcgcccccgctatgccgcgcggctcaacgcgttcaaacagctcacg
ccgggctcggatgtgcgggactggatcgcggcggcgggacaggtgggcggattgggggcg
gcggacctgaacttcccagaccattttgcggtctatgacgcggaccagatggggaatttt
ctgggggaggccgcgctgactttgaacgggatcgcgatgcggtactataccgaccccggt
ttcaaactgggcgcgttcacgcatcctgatgccgctgtcagacaggccgccttggatgtc
accaaacagggtatcgacacctgtgcccgcatgggcggcaaaacggtcactttgtggatg
gggcaggacgggttcgattatgcgtttcagatggattacgggctggcctgggatcgcacg
gtcgcggccatcgccgatatctgcgcccatgacccaaacatcgacatcgcgattgaatac
aaaccgaatgagccgcgggcctttgccctgatgccggatatcggcaccacgttgctggcc
tgccgcgaggtgggcgcggtcaatctgggcgtgacgctcgacttcgcccatgtcctttac
gccgatgagatgcccgcccattccgccgcgctgatcgggcggcattcgcggatgatcggc
ctgcatctgaacgacggctacggcaagcgcgacgatgggctgatggtgggctcggtccat
gccatccagaccgtcgaattgctggtcgcgatgctgcggatgggccagaccgatgtgatc
tatttcgacaccttccccgacatgggcggtctgaacccgattgaggaggcgcggaccaat
gtcgccgtcacggatcggcttatggcggttgcggaaagtctgatggaagatccagcgctg
gcgcaggcgattgaccggcaggatgcggcggcatcacaccggatcgtcgcgcgggccttg
tacggctcatga

DBGET integrated database retrieval system