KEGG   Jannaschia sp. CCS1: Jann_2292Help
Entry
Jann_2292         CDS       T00330                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein, PhoT family
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:jan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Jann_2292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jan02000]
    Jann_2292
Enzymes [BR:jan01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Jann_2292
Transporters [BR:jan02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Jann_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_29 Rad17 AAA_30 AAA_22 AAA_23 AAA_33 AAA_16 AAA_25 NB-ARC AAA_18 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABD55209
UniProt: Q28Q03
LinkDB All DBs
Position
2299207..2300058
Genome map
AA seq 283 aa AA seqDB search
MKDMSMSNPTESAAVTDMKMQARGVDVFYGAGASARSADDMAADKSVTHAIKEVDVDIAD
KTVTAFIGPSGCGKSTFLRVLNRMNDTIDGCRMTGKVTLEGEDIYDPKVDPVQLRAKVGM
VFQKPNPFPKSIFDNVAYGPRIHGLARNKADLSDIVEKSLRRAAIWEEVKDRLDAPGTGL
SGGQQQRLCIARAVATSPEVLLMDEPCSALDPIATAQVEELIDELRTRFSVVIVTHSMQQ
AARVSQKTAFFHLGNLVEFDETDKIFTNPSDPRTESYITGRIG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatgagtatgagcaacccaaccgaaagtgccgccgtgacggatatgaaaatg
caagcgcgcggcgtggatgtgttctacggggcaggggcctcggcccggtccgcggatgat
atggccgctgacaaatccgtcacccatgcgatcaaggaggtcgacgtcgacattgccgac
aagaccgtgacggcctttatcggcccgtcgggctgcggcaaatccaccttcctgcgcgtg
ctgaaccggatgaatgacaccatcgacggttgccgcatgaccggcaaggtcacgctggag
ggcgaagacatctacgacccgaaggtggacccagtccaactgcgcgccaaggtgggcatg
gtgttccagaaacccaacccgtttcccaagtcgattttcgacaacgtcgcctatggtccc
cgcatccatgggcttgcgcgcaacaaggcggatctgtctgacatcgtcgagaaatccctg
cgccgtgccgcgatctgggaggaggtcaaggaccgcctcgatgcgccggggacgggcctt
tcgggcggtcagcagcagcggctctgcattgcccgcgccgtcgccacctcgcccgaagtc
cttctgatggatgagccgtgttccgccctcgaccccatcgccactgcccaggttgaggaa
ctcattgacgagttgcgcacgcgcttttccgtcgtgatcgtcacccattccatgcagcag
gcggcgcgggtcagccagaagaccgcgttcttccacctcggcaacctcgtggaatttgac
gagaccgacaagattttcaccaaccccagcgatccccgcacggaaagctacattacgggc
cggattggataa

DBGET integrated database retrieval system