KEGG   Jannaschia sp. CCS1: Jann_2379Help
Entry
Jann_2379         CDS       T00330                                 

Definition
(GenBank) glycine cleavage T protein (aminomethyl transferase)
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00920  Sulfur metabolism
jan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Jann_2379
Enzymes [BR:jan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     Jann_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ABD55296
UniProt: Q28PR6
LinkDB All DBs
Position
complement(2383058..2384161)
Genome map
AA seq 367 aa AA seqDB search
MALISPSRRLRRTPFSDGVEASGVKAYTIYNRMLLPTLFRTVEEDYAHLKSAVQLWDVSV
ERQVEVRGPDAGRLVQMLTPRDLRGMLPGQCYYMPVVDETGGMLNDPVVLKLAEDRWWIS
IADSDLLLWVKGVAQGYRLDVLVDEPDVSPLAVQGPKADELMARVFGDSIRDVRFFRFGW
FDFQGHDMVIARSGYSKQGGFEIYVEGWDVGMPLWNALMEAGRDLDVHAGCPNNIERIEG
GLLSYGNDMTDDNTPHECGLGRFCNTATAVGCIGRDALLRVAKEGPVQQVRAIAIDADVL
PSCDRAWPLMAGKKRVGQLTSAAYSPDYSEGVAIGMVRMTHWDPGTQLHVQTPDGLMPAE
VREKFWI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatctctccgtcccgccgcctgcgccgcacccccttttctgatggggtggag
gcgtccggggtaaaagcctacacgatctataaccggatgctcctgcccaccctgtttcgt
acagtggaggaggattacgcccacctgaaatccgccgtgcaactctgggatgtctcggtg
gagcggcaggtggaggtgcgtggccccgatgcggggcgtctggtgcagatgcttaccccc
cgcgacctgcgcggcatgttgcccggccaatgctattacatgcccgtcgtggatgagacg
gggggcatgctcaacgatcccgttgtcctgaaactggccgaggaccgttggtggatctcc
atcgcggacagtgatttattgttgtgggtcaagggggtggcgcagggctaccgtctggac
gtattggtcgatgaacccgatgtgtcacccctggccgtgcagggccccaaggccgatgag
ctgatggcgcgggtcttcggcgacagcatccgcgacgtgcgcttcttccgcttcggctgg
ttcgactttcagggccacgatatggtcattgcgcgttctggctattccaagcagggcggg
ttcgagatctatgtggagggctgggatgtcgggatgccgctgtggaacgcgctgatggag
gccgggcgcgatctggatgtccacgccggttgccccaataatatcgagcggattgagggc
ggattgctcagctacggcaacgacatgaccgatgacaacacgccccacgaatgcgggttg
ggccggttctgcaacaccgccaccgccgtgggctgtatcgggcgcgacgcgctgttgcgg
gtggccaaggaaggtccggtgcagcaggtgcgcgccatcgcgattgatgcggatgtcctg
cccagttgcgaccgggcctggccgctgatggcgggcaagaagcgcgtggggcagttgacc
tccgccgcctatagccccgactacagcgaaggggtggccatcggcatggtgcgcatgacc
cattgggatccgggcacgcagctgcatgtccagacgcccgatggcctgatgcccgcagag
gtgcgtgagaaattttggatttga

DBGET integrated database retrieval system