KEGG   Jannaschia sp. CCS1: Jann_3324Help
Entry
Jann_3324         CDS       T00330                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00240  Pyrimidine metabolism
jan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Jann_3324
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Jann_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABD56241
UniProt: Q28M21
LinkDB All DBs
Position
3377122..3377736
Genome map
AA seq 204 aa AA seqDB search
MAHLRQNPPMAKLYFNYSTMNAGKSTLLLQASYNYIERGMQTYLLTANFDDRAGMGRIGS
RIGIEAEADTYTQSDDLFAKIDARLKAGPCACVLVDEAQWMTRDQVWQLARAVDDLGVPV
MCYGLRVDFRGELFPGSAALLALADEMREVRTICHCGRKATMVIRVGEDGNALAEGAQIE
VGGNDRYISLCRKHFREAVGDVPV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcccacttgcggcaaaacccgcccatggccaagctctatttcaactactccaccatg
aatgcgggcaaatcgaccctgctgttgcaagcctcctacaattatatcgaacgggggatg
cagacctatctgctgaccgcgaatttcgatgatcgtgcgggcatgggacggatcgggtcg
cgcatcgggatcgaggcggaggccgatacctacacccaatccgatgatctgtttgccaag
attgacgcgcggctgaaggccggcccctgcgcctgcgtgctggtggatgaggcccaatgg
atgacccgcgatcaggtctggcaactggcccgtgccgtggatgatctgggcgtgccggtg
atgtgctacgggctgcgggtggatttccgcggagagctgttccccggctccgccgccctt
ctggcgctggccgatgagatgcgggaggtgcgcacgatctgccattgcgggcgcaaggcc
acgatggtgatccgcgtgggcgaagatggcaacgccctggccgaaggcgcgcagatcgag
gttggcggcaacgaccgctatatcagcctgtgccgcaagcatttccgcgaagccgtgggc
gacgtccccgtctga

DBGET integrated database retrieval system