KEGG   Jeotgalibaca arthritidis: G7057_03530
Entry
G7057_03530       CDS       T06477                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01215  glucan 1,6-alpha-glucosidase [EC:3.2.1.70]
Organism
jar  Jeotgalibaca arthritidis
Brite
KEGG Orthology (KO) [BR:jar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G7057_03530
Enzymes [BR:jar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.70  glucan 1,6-alpha-glucosidase
     G7057_03530
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Glyco_hydro_42C
Other DBs
NCBI-ProteinID: QII81638
LinkDB
Position
complement(701410..703038)
AA seq 542 aa
MLEKWWHQSVVYQIYPRSFQDSNHDGIGDIRGIISRLDYLKELGIDVIWLSPVYQSPNDD
NGYDISDYQAIHPDFGTMADMDDLIEQAKERGIRIVMDLVVNHTSDEHKWFVEARKNKDN
PYRDYYVWRDPVDEKEPNGMRSTFSGPAWEFDEETGQYYLHLFSKKQPDLNWENEAVRRE
VYDMMNFWIDKGIGGFRMDVIDLIGKIPDQEITGNGPKLHDYLQEMNQQTFGAADLLTVG
ETWGATPEIAKAYSHPDRHELSMVFQFEHVGLDQQEGKDKWDLKALSIPKLKAVLSKWQV
SLGEEGWNSLFWNNHDLPRIVSRWGNDGEYRRQSAKMFAILLHMMKGTPYIYQGEEIGMT
NYPIADISEADDIETINMYHERLAEGYSKESLLASINAKGRDNARRPVQWDSSNQAGFTN
GTPWLAVHPNYQTINVADSLADEDSIFYTYQKLIQLRKEHPIIVYGSYTLLLEEDPVIFA
YLREYEGKRWLVCANFSEEVQKLQLEVDETESKPIIQNYQRDFYDLSELVLEPYETFVVE
LD
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgttagaaaaatggtggcaccaatctgtggtgtatcaaatttacccccgaagctttcaa
gacagtaatcatgatggtattggcgatataagaggaattatttcccgtttagattattta
aaagaactaggaattgacgtcatttggctgagtcctgtttaccaatcacctaatgatgat
aatggttatgatatcagtgattaccaagccattcatcccgactttggcacgatggcggat
atggatgatttaatcgaacaagccaaagaacgcggtattcgtatcgtgatggatttagtg
gttaatcatacatctgacgagcacaagtggtttgtcgaagctagaaaaaataaggacaat
ccttaccgcgactactacgtttggcgcgaccccgttgacgaaaaagaaccaaacggcatg
cggtcaacatttagcggtcctgcctgggaatttgacgaagaaacgggccaatattatttg
catttatttagtaaaaagcaacccgacttgaattgggaaaatgaagccgttcgccgagaa
gtttacgacatgatgaatttttggattgataaaggaattggtggcttccgtatggatgtc
attgacctcatcggaaaaatacccgatcaagaaattacaggtaatgggccaaaactccat
gattatttgcaggagatgaaccaacaaacctttggagctgcagatttattaacggttggc
gaaacatggggggcaactcctgagattgccaaagcttactcccatcctgaccgtcatgaa
ctgtctatggtctttcaatttgagcacgttggcttagaccagcaggaaggtaaagacaag
tgggatctgaaagccttatcgattccgaaactaaaagcagtgctttccaaatggcaagta
tcgctcggtgaggaagggtggaatagcttgttttggaacaaccatgacctgccgcggatt
gtgtcgcgttggggaaatgatggcgaataccgccgtcaaagtgccaagatgtttgcgatt
ttgctgcatatgatgaaggggacgccctatatttatcaaggtgaggaaattggaatgact
aattatccaatcgctgatatttctgaagccgacgatattgaaacgatcaatatgtatcat
gaacgccttgcggaaggttattcaaaagagagcttgttggcatctattaatgccaagggt
cgcgataatgcgcgccgccctgtgcaatgggatagcagcaaccaagctggattcacaaat
ggcacgccatggctggcggttcatcccaattatcaaaccattaatgtggctgatagttta
gccgatgaggattctattttctatacgtatcaaaaactgattcagctgcgtaaagaacat
ccaattatcgtttatgggagctatactttgttactggaagaagatccagttatttttgct
tacttgagagagtatgaagggaaacggtggttggtgtgtgccaactttagtgaagaggtt
caaaagctacaactagaagtggatgaaacagagtcgaaaccgattattcaaaattatcaa
cgcgacttttatgacctttcggagctagttttagaaccgtatgagacatttgtagtcgaa
ttagactaa

DBGET integrated database retrieval system