KEGG   Janthinobacterium sp. SNU WT3: FJQ89_17415Help
Entry
FJQ89_17415       CDS       T06359                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jas  Janthinobacterium sp. SNU WT3
Brite
KEGG Orthology (KO) [BR:jas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FJQ89_17415 (ahpF)
Enzymes [BR:jas01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FJQ89_17415 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO HI0933_like Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase NAD_binding_7 AlaDh_PNT_C Glutaredoxin FMO-like Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: QDG71988
UniProt: A0A4Y6RG53
LinkDB All DBs
Position
complement(3974384..3975979)
Genome map
AA seq 531 aa AA seqDB search
MLDATLKTQLKSYLEKVVYPLELVASLDDSAKAREMKELLQEIVLLSDKITLVERLDAGV
RAPSFSINRTGSDIGVRFAGVPLGHEFTSLVLALLQVGGHTIKFDDAVIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMAVINPRIKVTTIDGGVFPKEVEERQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAAALSKKDVFDVLIVGGGPAGAAAAIYAARKGIKTGV
LAERFGGQTLDTMAIENFISVKETDGPKFAMALEQHVKTYDVDIMNTQRASKLTPGKLIE
IETANGAILKAKTVILATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVKHVTLIEFGAELRADAVLQRKLHSLPNVTVITSAQTTEIHGDGKIV
NGLSYTDRVSGESKKVELEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSIPGVF
AAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVEESAVKEALTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaccctcaaaacccaactgaaatcctacctggaaaaagtggtgtatccg
cttgagctggtcgcttctctcgatgacagcgcaaaagcccgcgagatgaaggaattgctc
caggagatagtcctgttgagcgacaagatcacgctggtcgagcgccttgacgctggcgta
cgggcgccgtcgttcagcatcaaccgtaccggctccgatatcggcgtgcgtttcgccggt
gtgccactgggccacgaatttacctcgctcgtgctggcgctgctgcaagtgggcggccac
accatcaagttcgacgacgccgtgatcgagcagatccgcaacctcgacggcgattacgag
tttgaaacgtttatttcgctctcctgccataactgcccggaagtggtgcaggcattgaat
gccatggcggtgatcaacccgcgcatcaaggtcaccaccatcgatggcggcgtgttcccg
aaagaagtggaagagcgccagatcatggccgtgccgatgatgttcctgaatggcgagcac
ttcggccagggacgcacgaatgtcgaggaaatcctcgccaagctcgacaccaacgccggc
gcacgccaggcggcagcgttgtcgaaaaaagatgtctttgatgtactgatcgtcggcggc
ggtcctgccggcgcggcagcggccatctatgcggcccgcaaaggcatcaagacgggcgtg
ctggccgagcgtttcggcggccagaccctcgacaccatggccatcgagaatttcatttcc
gtcaaggaaaccgatggtccgaagtttgccatggcgctggaacagcacgtcaagacctat
gacgtcgatatcatgaacacccagcgcgccagcaagctgaccccaggcaagctgatcgag
attgaaacggcgaatggcgccatcctgaaagccaagaccgtcatcctggccaccggtgcc
cgctggcgcgaaatcaatgtgccgggcgagaaggaataccgcaaccacggtgtcgcttac
tgcccgcactgcgatggccccttgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactcgggtgtggaagcggcgatcgacctggccggcctggtaaagcacgtgaccctgatc
gagttcggcgcggaattgcgtgccgatgcggtgctgcaacgcaagctgcacagcctgcct
aacgtgaccgtgatcacctcggcgcaaaccaccgagatccacggcgacggcaagatcgtc
aatggcctcagctacacggaccgggtcagcggcgagtcgaaaaaggtcgagctggaaggc
gttttcgtgcaaatcggcctggtgccgaacacggagtggctgaaggggacagtggcactg
tcgcgccacggcgaaatcgaagtcgatgcccgcggccagacctcgatcccaggcgtattt
gcggccggcgacgtcaccacggtgccgtacaagcagatcatcatcgccaccggcgaaggc
gccaaggcagccctgtccgcctttgaccacctgatccgctcggatgacgaggaagtggtt
gaagagtccgcagtcaaggaagcactgacggcgtaa

DBGET integrated database retrieval system