KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_00085Help
Entry
YQ44_00085        CDS       T04539                                 

Definition
(GenBank) cytochrome C550
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00550  Peptidoglycan biosynthesis
jaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YQ44_00085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:jaz01002]
    YQ44_00085
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jaz01011]
    YQ44_00085
Enzymes [BR:jaz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YQ44_00085
Peptidases and inhibitors [BR:jaz01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   YQ44_00085
Peptidoglycan biosynthesis and degradation proteins [BR:jaz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YQ44_00085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Psu
Motif
Other DBs
NCBI-ProteinID: APA66484
UniProt: A0A1I9XRU2
LinkDB All DBs
Position
complement(15612..16757)
Genome map
AA seq 381 aa AA seqDB search
MKKLLAALASSVFFLSAAHAQSVPAPTIAAKSWLLLDATSGQIIASQDPDARIEPASLTK
IMTAYLTFAAIREKKLALDQKVNVSVRAWKVDSSSSKMFIDPATPVSIDDLLHGLMIQSG
NDAAVALAEAVAGDEGTFVVLMNREAQRMGMKNTRFANPHGLPSPDNFSTAQDLSVLAQR
VIADYPEFYKIDSIKSFTYNKITQPNRNRLLWLDPTVDGMKTGHTEAAGYCMIASARRPG
GTGERRLISVMLGTSSDQARTQESQKLLNWGFQNFDTVKLYSKGQAVATPEVWKGSKGTV
KIGFARDVLVTVPKGTAAKMKPVLERKDPLVAPLAENAPVGKLKMMVDDKVLLELPVVAL
ETINQATIFGRAWDSMRLWMK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttttagcggcactggcctccagtgtatttttcctatccgccgcccacgcc
cagagcgtccccgcaccgaccatcgccgccaaatcctggctgttgcttgacgccaccagt
ggccagatcattgcctcgcaagatccggacgcccgcatcgagccggcgtcgctgaccaag
atcatgacggcttacctgacgtttgccgccatccgcgaaaagaagctggcgctggaccaa
aaagtgaatgtgtccgtgcgcgcatggaaagtcgactcgagcagctcgaagatgttcatc
gacccggccacgcccgtgtcgatcgacgacttgctgcatggcctgatgattcaatcgggt
aacgacgccgccgtggcgctggctgaagccgttgctggcgatgaaggcacgttcgtcgtg
ctgatgaaccgcgaagcgcagcgcatggggatgaaaaacacgcgttttgccaatccgcat
ggcttgcctagcccggataatttttccacggcgcaagacctgtccgtgctggcccagcgc
gtgatcgccgactatccggaattctacaagatcgattcgatcaagagtttcacctacaac
aagatcacccagcctaaccgcaaccgcctgctgtggctggacccaaccgtggacggcatg
aagacgggccacacggaagcggctggctattgcatgatcgcctcggcccgccgtccaggc
ggcaccggcgagcgccgcctgatctccgtgatgctgggcacttcgtccgaccaggcccgt
acgcaggaaagccagaagctgctgaactggggcttccagaacttcgatacggtcaagctg
tactcgaaaggccaggccgtggccacgccggaagtatggaaaggctcgaaaggcaccgtg
aaaatcggtttcgcgcgcgatgtgctcgtcaccgtaccgaaaggcacggccgccaagatg
aaaccggtgctggaacgcaaggacccgctggtcgctccgctggccgagaacgcccctgtc
ggcaagctgaaaatgatggtcgacgacaaggttctgctggaactgcctgtcgtggcgctg
gaaaccatcaaccaggccaccatcttcggccgcgcctgggattccatgcgcctgtggatg
aagtaa

DBGET integrated database retrieval system