KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_07800Help
Entry
YQ44_07800        CDS       T04539                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00061  Fatty acid biosynthesis
jaz00780  Biotin metabolism
jaz01100  Metabolic pathways
jaz01130  Biosynthesis of antibiotics
jaz01212  Fatty acid metabolism
Module
jaz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YQ44_07800
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YQ44_07800
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YQ44_07800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:jaz01004]
    YQ44_07800
Enzymes [BR:jaz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     YQ44_07800
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     YQ44_07800
Lipid biosynthesis proteins [BR:jaz01004]
 Fatty acid synthase
  Component type
   YQ44_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: APA67763
UniProt: A0A1I9XVH1
LinkDB All DBs
Position
complement(1751323..1752111)
Genome map
AA seq 262 aa AA seqDB search
MAFLQGKKILITGLLSNRSIAYGIAKACHREGATLAFTYVGERFKERITEFAAEFGSELV
FDCDVSSDEQISAVFGDLAQHWEQLDGLVHAIGFAPREAIAGDFLDGLSRDSFRIAHDIS
AYSFPAMAKAALPLLHPGASVLTLTYLGAVRAVPYYNTMGLAKASLEASVRYLAESLGPR
GIRANGISAGPIKTLAATGIKDFSKLLGFVAEHAPLRRNVTIEEVGNTAAFLLSDLASGI
TGEITYVDGGFSQVMAVNPEVE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctttcttgcaaggcaaaaaaattcttatcacgggcctgctgtcgaatcgctcgatt
gcctatggcatcgccaaggcttgccaccgcgaaggcgccaccctggccttcacctatgtg
ggcgaacgcttcaaggagcgcatcacggaatttgcggccgaattcggcagcgaactggtg
ttcgactgcgacgtgtccagcgacgagcagatcagcgccgtcttcggcgacctggcgcag
cactgggaacaattggacggtctggtgcacgccatcggcttcgccccgcgcgaagcgatc
gccggcgacttcctcgacggcctgtcgcgcgacagtttccgcatcgcgcacgacatttcc
gcctacagcttccccgccatggccaaggccgccctgccgctgctgcatccgggcgcctcg
gtattgacgctgacatacctgggcgccgtgcgcgccgtgccctactacaacaccatgggc
ctggccaaggcgtcgctggaagcgtccgtgcgctacctggccgaatcgctgggtccgcgc
ggcatccgcgccaacggcatctcggccggccccatcaagaccctggccgcgaccggcatc
aaggacttcagcaagctgctgggctttgtcgccgagcacgccccgctgcgccgcaacgtc
accatcgaggaagtcggcaatacggccgctttcctgctgtccgacctggcctcgggcatt
acgggcgagattacctacgtcgatggcggcttttcgcaagtgatggcggtcaatccggaa
gtggagtga

DBGET integrated database retrieval system