KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_14670Help
Entry
YQ44_14670        CDS       T04539                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00061  Fatty acid biosynthesis
jaz00780  Biotin metabolism
jaz01100  Metabolic pathways
jaz01212  Fatty acid metabolism
Module
jaz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YQ44_14670 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YQ44_14670 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:jaz01004]
    YQ44_14670 (fabZ)
Enzymes [BR:jaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YQ44_14670 (fabZ)
Lipid biosynthesis proteins [BR:jaz01004]
 Fatty acid synthase
  Component type
   YQ44_14670 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT AfsA
Motif
Other DBs
NCBI-ProteinID: APA68833
UniProt: A0A1I9XYJ1
LinkDB All DBs
Position
complement(3405868..3406362)
Genome map
AA seq 164 aa AA seqDB search
MTTEKKTLDILAIKSLLPHRYPLLLVDRVLDWEANKSITAIKNVTVNEEFFQGHFPHKPV
MPGVLMIEALAQTAALLSFLTMGVKPDENSVVYFVGIDNARFKRPVEPGDQLKMDVEILR
VSRGIWKYKAVGSVDGKVALEAELMCTIRSAQDASQSASQPAGQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaaaaaagaccctcgacatcctggccatcaaatcgctgctgccgcaccgc
tatccgctgctgctggtcgaccgcgtgctggactgggaagcgaacaaatccatcaccgcc
atcaagaacgtgacggtcaatgaagagttcttccagggccacttcccgcacaagccggtc
atgcctggcgtgctgatgatcgaagcgctggcgcagacggcggccttgctgtcgttcctg
acgatgggcgtcaagcccgatgagaattcggtggtgtacttcgtcggcatcgacaatgcg
cgtttcaagcgtcctgtcgaaccgggcgaccagctgaagatggacgtcgaaatcctgcgc
gtctcgcgcggcatctggaaatacaaggcggtcggctcggtcgacggcaaggtcgcgctg
gaagcggaactgatgtgcaccatccgcagcgcgcaggatgcaagccagtctgcgagccag
ccagcggggcagtaa

DBGET integrated database retrieval system