KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_18010Help
Entry
YQ44_18010        CDS       T04539                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00620  Pyruvate metabolism
jaz00680  Methane metabolism
jaz01100  Metabolic pathways
jaz01120  Microbial metabolism in diverse environments
jaz01200  Carbon metabolism
Module
jaz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YQ44_18010
  09102 Energy metabolism
   00680 Methane metabolism
    YQ44_18010
Enzymes [BR:jaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YQ44_18010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APA69354
UniProt: A0A1I9Y012
LinkDB All DBs
Position
4167619..4170459
Genome map
AA seq 946 aa AA seqDB search
MLNDAVAPETAAPVPADKDAPLKEDIRLLGRLLGDVLREQEGDAVFNVVETIRQTSVRFR
READADAALELDAMLKELSREQTISVVRAFSYFSHLANIAEDQHHIRRRRAHLLAGSPAQ
KGSVSFALKKLRAAGVPRKTVDTFFQDALIAPVLTAHPTEVQRKSILDAEHDIARLLAER
DLPLTPKERHANMQLLRSRVSTLWQTRMLRYSKLTVADEIENALSYYRITFLRELPGLYD
DIEDDIAAEYPNGDGTIEPINAAYVQMGSWIGGDRDGNPNVNAGTMQHALARHATTILDF
YLDEVHTLGAELSVSTLMVGVSGELQALADQSPDASPHRSDEPYRRALIGIYARLAATAR
ALGATNILRKEVGPAAAYPDAAAFVADLRTIVASLEAHHGAALVRPRLATLARAADIFGF
HLASLDMRQTSDVHERVLADLFAKSGVAPDYAALAEDAKEALLLNELAQPRLLYSPYIAY
DAETDSELAILRAARDIRQRYGARAIRNYIISHTETVSDLLEVLLLQKETGLLRTDWHAG
ESTCELMVIPLFETIPDLQRAAGIMGRVMALPLVRQLIAKQGQLQEVMLGYSDSNKDGGF
LTSNWELYKAELALVADFRKAGVKLRLFHGRGGTVGRGGGPSYEAILAQPPGTVNGQIRL
TEQGEIIASKFSNAEIGRRNLELLVAATLEASLAPQEVNPARNNQLARFEGVMAELSNLA
YKAYRDLVYETPGFTEYFFSATPIAEIAELNLGSRPASRKANQRIEDLRAIPWGFSWGQC
RLLLPGWFGFGSAIHAWINDGETASKDDKIATLRTMYAQWPFFATLLSNMDMVLAKTDLA
IASRYAELVADQGLRERIYKRITDEHGTTLQCLELITGNTERLAGNPLLARSIQNRFAYL
DPLNHLQVELIKRNRALSAESKIDERVHRGIQLSINGVAAGLRNTG
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgacgccgtagcacccgaaaccgccgccccggtccctgccgacaaggacgcg
ccgctgaaagaagatatccgcctgctgggccgcctgctgggcgacgtgctgcgcgaacag
gaaggcgacgccgtcttcaacgtggtggaaaccatccgccagacctcggtgcgcttccgc
cgcgaagcggacgcggacgcggcgctggaactggacgccatgctgaaggaactgagccgc
gaacagacgatttccgtcgtgcgcgccttttcctacttttcgcacctggccaacattgcg
gaagaccagcaccacatccgccgccgccgcgcgcacctgctggccggttcgcccgcgcaa
aagggcagcgtcagcttcgcgctgaaaaaactgcgcgccgccggcgtgccgcgcaagacg
gtcgacaccttcttccaggacgcgctgatcgcgcccgtgctgacggcccacccgacggaa
gtgcagcgcaagagcatcctcgacgccgagcacgacatcgcccgcctgctggccgagcgc
gacctgccgctgacgccgaaggagcggcacgccaacatgcagctgctgcgctcgcgcgta
tccacgctgtggcagacgcgcatgctgcgctattcgaagctgacggtggccgacgagatc
gaaaacgccctgtcctattaccgcatcaccttcctgcgcgagctgccgggcctgtacgac
gacatcgaggacgacatcgccgccgaatatccgaacggcgacggcacgatcgagcccatc
aatgccgcctacgtgcagatgggcagctggatcggcggcgaccgcgacggcaatccgaac
gtcaacgcgggcaccatgcagcacgcgctggcgcgccacgccaccaccatcctcgacttt
tacctcgacgaagtgcacacgctgggcgcggaactgtccgtctcgaccctgatggtgggc
gtcagcggcgaactgcaggcgctggccgaccagtcgccggacgcctcgccgcaccgcagc
gacgaaccgtaccgccgcgccctgatcggcatctatgcgcgcctggccgccaccgcgcgc
gccctgggcgccaccaacatcctgcgcaaggaagtggggccggccgccgcctacccggac
gcggccgcgtttgtcgccgacctgcgcaccatcgtcgcctcgctcgaagcgcaccatggc
gcggccctcgtgcgcccgcgcctggccacgctggcgcgcgcggccgacatcttcggcttc
cacctggcgtcgctcgacatgcgccagacctccgacgtgcacgagcgcgtgctggccgac
ctgttcgccaagagcggcgtggcgcccgactatgcggccctggcggaagacgccaaggaa
gcgctgctgctgaatgaactggcgcagccgcgcctgctgtattcgccctacatcgcctac
gacgcggaaacggattccgagctggcgatcctgcgcgcggcgcgcgacatccgccagcgc
tacggcgcgcgggcgatccgcaactacatcatctcgcacacggaaaccgtgtccgacttg
ctggaggtgttgctgctgcaaaaagaaacgggcttgctgcgcaccgactggcatgctggc
gagagcacgtgcgagctgatggtcatccccctgttcgaaaccatccccgacctgcagcgc
gcggccggcatcatgggccgcgtgatggccttgcccctggtccggcaattgatcgccaaa
cagggacagttgcaggaagtcatgctcggctattccgattcgaacaaggatggcggcttc
ctcacgtcgaactgggaactgtacaaggcggaactggcgctggtggccgacttccggaag
gctggcgtcaagctgcgcctgttccatggccgcggcggcacggtgggccgtggcggcggc
cccagctacgaagccatcctggcccagccgccgggcaccgtcaacgggcagatccgcctg
acggaacagggcgagatcatcgcctcgaagttttccaacgcggaaatcggccggcgcaac
ctggaattgctggttgccgccacgctggaagcgagcctggcgccgcaagaggtcaacccg
gcccgcaacaaccagctggcgcgcttcgagggcgtgatggcggaactgtcgaacctggcc
tacaaggcctatcgcgacctcgtgtatgaaacgccggggtttaccgagtatttcttctcg
gccacgccaatcgccgaaattgccgagctgaaccttggttcgcgccccgcctcgcgcaag
gccaaccagcgcatcgaagacttgcgcgccattccctggggcttttcctggggtcagtgc
cgtttactgctgccgggctggttcggctttggcagcgccatccacgcctggatcaatgac
ggcgagacagcgtcgaaggacgacaagatcgccaccctgcgcaccatgtacgcgcagtgg
ccgttcttcgccaccctgctgtcgaacatggacatggtgctggccaagacggacctggcg
attgcctcgcgctacgcggaactggtggccgaccagggcttgcgcgagcgcatctacaag
cgcatcacggacgagcatggcactaccctgcaatgcctggagctgatcacgggcaacacg
gaacgcctggccggcaacccgctgctggcccgctccatccagaaccgcttcgcctacctg
gacccgctcaaccacttgcaggtggagttaatcaaacgcaaccgcgcactgtcggcggaa
agcaagatcgatgaacgcgtgcaccgcggcatccagctgtcgatcaacggcgtggcggcc
ggcctgcgcaacacgggctag

DBGET integrated database retrieval system