KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_22265Help
Entry
YQ44_22265        CDS       T04539                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00010  Glycolysis / Gluconeogenesis
jaz00620  Pyruvate metabolism
jaz01100  Metabolic pathways
jaz01110  Biosynthesis of secondary metabolites
jaz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YQ44_22265
   00620 Pyruvate metabolism
    YQ44_22265
Enzymes [BR:jaz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     YQ44_22265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APA70057
UniProt: A0A1I9Y215
LinkDB All DBs
Position
complement(5162659..5164179)
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVANPFKQRYDNYIGGKFVAPVKGEYFPNITPITGLPFCEIARSTTEDVEL
ALDAAHAAKEAWGKTSPAERANILNRIADRIEQNLSLIATAETIDNGKPIRETMNADIPL
AIDHFRYFAGCIRAQEGSVAQIDAETYAYHYHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIGDLLPPGVLNIINGFGLEAGKPLASSKRIAKIAFTG
ETGTGRLIMGYAAQNLIPVTLELGGKSPNIFFEDVMDADDDYFDKCLEGFTMFALNQGEV
CTCPSRVLIQESIYEKFIERALKRVAAIKQGNPLDTATMIGAQASQEQLEKILSYLDIGR
QEGAEVLAGGERNTQAGDLEGGYYVRPTVFKGNNKMRIFQEEIFGPVVSVTTFKDEAEAL
AIANDTLYGLGAGLWTRDGSRAFRVGRAIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgcagacatcagcaaactgggcgtcgccaaccctttcaagcaacgttacgat
aactacattggcggcaagttcgtggcccccgtcaaaggtgaatactttcccaacattacg
ccgatcacgggcttgccgttttgcgaaattgcccgctccacgacggaagacgtcgagctg
gcgctggacgccgcccatgccgccaaggaagcctggggcaagacgtcgcctgccgagcgc
gccaatatcctgaaccggatcgccgaccgcatcgagcaaaacctcagcctgatcgccacg
gcggaaaccatcgacaacggcaagcccatccgcgaaacgatgaatgccgatattccgctg
gccatcgaccatttccgctacttcgccggctgcatccgcgcccaggaaggctccgtcgcg
caaatcgatgcggaaacctatgcctatcactaccacgagccgctgggcgtcgtgggccag
atcatcccctggaatttcccgatcctgatggccgtgtggaaactggcgccggccctggcc
gccggcaattgcgtggtgctgaaaccggccgaacagacgccggcttccatcatggtcttg
atcgagctgatcggcgacctgctgccgccgggcgtgttgaacatcatcaatggtttcggc
ctggaagcgggcaagccgctggcgtcgagcaagcgcatcgccaagatcgcgtttacgggc
gaaacgggcacgggccgtctgatcatgggttacgcggcgcaaaacctgattcccgtcacc
ctggaattgggcggcaagtcgccgaacatcttctttgaagacgtgatggatgccgatgat
gactatttcgacaagtgcctggaaggcttcacgatgtttgcgctgaatcaaggcgaagtg
tgcacctgcccatcgcgcgtactgatccaggaatcgatctacgagaaattcatcgaacgg
gccctgaagcgcgtggccgccatcaagcagggcaatccgctcgatacggccaccatgatc
ggcgcccaggcgtcgcaggaacagctggaaaaaatcctgtcctacctcgatatcggccgc
caggaaggcgccgaggtgctggccggcggcgagcgcaacacgcaggcgggcgatctcgag
ggcggctattacgtgcgtccaaccgtattcaagggcaacaacaagatgcgcatcttccag
gaagagatttttggtcccgtcgtgtccgtcacgaccttcaaggatgaggctgaagccttg
gcgatcgccaacgacaccctgtacggcctcggtgccggcctgtggacgcgtgacggttcg
cgcgccttccgcgtgggccgcgccatccaggcgggccgcgtatggacgaattgctatcac
ctgtacccggcccatgccgcgttcggtggctacaagcaatcgggtatcggccgcgaaaac
cacaagatgatgctcgaccactaccagcaaacgaagaacttgctggtgagctatagcccg
aaagcgctgggcttcttctaa

DBGET integrated database retrieval system