KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_27665Help
Entry
YQ44_27665        CDS       T04539                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YQ44_27665
Enzymes [BR:jaz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     YQ44_27665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin AlaDh_PNT_C Phage_TAC_11 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: APA70973
UniProt: A0A1I9Y4N1
LinkDB All DBs
Position
6373097..6374692
Genome map
AA seq 531 aa AA seqDB search
MLDATLKTQLKSYLEKVVYPLELVASLDDSAKAREMKELLQEIVLLSDKITLVERIDAGV
RTPSFSINRTGSDIGVRFAGVPLGHEFTSLVLALLQVGGHTIKFDDAVIEQIRNLDGDYV
FETFISLSCHNCPEVVQALNAMSVINPRIKVTTIDGGVFPKEVEERQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAEALNKKDVFDVLIVGGGPAGAAAAIYAARKGIKTGV
LAERFGGQVLDTLAIENFISVKETDGPKFAMALEQHVKEYEVDIMNTQRATKLTPGKLVE
IETANGAVLKAKTVILATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVKHVTLIEFGAELRADAVLQRKLHSLPNVTVITSAQTTEIHGDGKIV
NGLSYTDRISGESKKVELEGVFVQIGLVPNTEWLKGTLALSRHGEIEVDARGQTSIPGVF
AAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVEESAAKEALTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaccctcaaaacccaactgaaatcctacctggaaaaagtggtgtatccg
cttgagctggtcgcttctctcgatgacagcgcaaaagcccgcgagatgaaggaattgctc
caggagatagtcctgttgagcgacaagatcacgctggtcgagcgcattgacgctggcgta
cggaccccgtcgttcagcatcaaccgtacaggctccgacatcggcgtgcgtttcgccggt
gtgccgctgggccatgaattcacgtcgctggtgctggcgctgctgcaagtgggcggccac
accatcaagttcgacgatgccgtgatcgagcagatccgcaacctcgacggcgactatgtc
tttgaaacgtttatttcgctgagctgccataactgcccggaagtggtgcaggcgctcaat
gcgatgtcggtgatcaacccgcgcatcaaggtcaccaccatcgacggcggcgtgttcccg
aaagaagtggaagaacgccagatcatggccgtgccgatgatgttcctgaatggcgagcat
ttcggccagggacgcacgaatgtcgaggaaatcctcgccaagctcgacaccaacgccggc
gcccgtcaggccgaagcgctgaacaagaaagacgtgttcgacgtgctgatcgtcggcggc
ggccctgccggcgcggcagcggccatctatgcggcccgcaagggcatcaagacgggcgtg
ctggccgagcgtttcggcggccaggtgctcgataccctggccatcgagaattttatttcc
gtcaaggaaacggacggtcccaagttcgccatggcgctggaacagcatgtcaaggagtac
gaggtcgacatcatgaacacccagcgcgcgacgaagttgacgccgggcaagctggtcgag
attgaaacggcgaatggcgccgtcctgaaagccaagaccgtgattttggccaccggcgcc
cgctggcgcgaaatcaacgtgccgggcgagaaggaataccgcaaccacggtgtcgcctac
tgcccgcactgcgacggtcccttgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactcgggcgtggaagcggcgatcgacctggccggcctcgtgaaacacgtgaccctgatc
gagttcggcgcggaactgcgtgccgatgcggtgctgcaacgcaagctgcacagcctgccc
aacgtgaccgtgatcacctcggcgcagacgaccgagatccacggcgacggcaagatcgtc
aatggcctcagctacacggaccgcatcagcggcgagtcgaaaaaggtcgaactggaaggc
gtcttcgtgcagatcggcctggtgccgaacacggagtggctgaaaggcaccctggccctg
tcgcgccacggcgaaatcgaagtcgatgcccgcggccagacctcgatccccggcgtgttc
gcggccggcgacgtcaccacggtgccgtacaagcagatcatcatcgccaccggcgaaggc
gcgaaggcagccctgtccgcctttgaccacctgatccgctcggacgacgaggaagtggtt
gaagagtctgcagcgaaagaagcactgacggcgtaa

DBGET integrated database retrieval system