KEGG   Jatropha curcas: 105628539Help
Entry
105628539         CDS       T03922                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A isoform X2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
jcu  Jatropha curcas
Pathway
jcu00562  Inositol phosphate metabolism
jcu01100  Metabolic pathways
jcu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105628539
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105628539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jcu01009]
    105628539
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105628539
    3.1.3.48  protein-tyrosine-phosphatase
     105628539
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105628539
Protein phosphatases and associated proteins [BR:jcu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105628539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 105628539
NCBI-ProteinID: XP_012065393
UniProt: A0A067LF72
LinkDB All DBs
Position
Unknown
AA seq 613 aa AA seqDB search
MDSGPVDSSTSSVKAPDVQTHAATDPGVDNSPRDAPPKLSAAGITSWAKSLKIPQPLAPS
QGDSPTGSPGKSTFARFTSGFVLRSSPKSPVTDDSSEGPSSPSQPGFIGTITKGLVDTSK
NAVKAVQVKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYR
NHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQS
AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDGKGLV
LPSQIRYVKYFERVLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKK
HPRTKELSPEDYWFSAPKKGIMVFALPGEPGLAEVAGDFKVHFHDRQGDFYFWLNTTMME
NRKVLNTGDIDGFDKRKLPSPGFQVEVVLVDYNGTVPSSQDSEAAANKSNEGSSAAPGPV
DTGVAAAVPNQDKERGSNDKDDVFSDGEAEESVSSKLKQAQAASAGERTATTITSSEETN
TKSDQVASLTRATEQLSLGNTGSQPSATQPKSDAVGEAAVLGLGINNSESEFKAMAADVS
VFTFGDDEDYESE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggattctggacctgttgattcatcaacttcgtctgttaaagctcccgatgtacaaact
catgctgctacagatcctggagtggataattccccacgtgatgcgcctccaaagctatct
gcagctggcataacatcatgggccaaaagtttgaaaattccccagccattggctccctca
caaggtgactcaccaactggaagccctggaaaatcaacctttgcccgttttacaagtgga
tttgtactgcgctcatctccgaaatctcctgtaactgatgatagttctgaagggccttca
tcaccttcacaacctggttttattggaacaatcactaaaggtttagttgatacatctaag
aatgcagtgaaggcagtacaagtcaaggctcgtcatgctgtctctcaaaataagcgaaga
taccaggaaggaggatttgatttggatatgacatatatcacagagaatataattgccatg
gggttccctgctggtgatatgagctctggtttttttggatatgttgagggattttatcga
aatcacatggaagaagtgattaagttttttgaaactcatcacaagggcaagtacaaagtg
tacaatctttgttccgagaggctatatgatgcatcattgtttgaaggaaaggtggctagt
tttccatttgatgatcacaattgccctccaattcaacttatcatatcattttgccaaagt
gcttattcatggttgaaggaggatattgagaatgttgtggtggtgcactgtaaggctgga
atggcaaggacagggctaatgatttctagccttcttctatacttaaagttctttcctaca
gctgaagaatccattgactactataaccagaagaggtgttttgatggaaaagggcttgtt
ctgccaagtcaaattagatatgtaaaatattttgaacgtgtcttaacatacttcaatggc
gaaaaccaaccagggcgtaggtgcatgcttaggggttttcgtcttcaccgatgcccttat
tggattaggccttctattactgtctctgatcataatggtgttctcttctccacaaaaaag
catcctagaaccaaggaattatcgccagaagattattggtttagtgcaccaaagaagggc
atcatggtctttgctttgcctggggaacctggtctagccgaggttgctggagactttaaa
gtccattttcatgaccgccaaggagatttttatttttggttaaatacaacaatgatggaa
aatagaaaggttttgaacaccggtgacatcgatgggtttgacaagagaaaactgccttcc
cctggattccaggtcgaggttgtgctagtagattacaatggcactgttccatcaagtcaa
gacagtgaggctgctgctaacaagtcgaatgaaggttcaagtgctgctcctggtccagtt
gatactggtgtggcagcagctgttccaaaccaagataaagagcgcggaagtaatgataaa
gatgatgtattttcagatggtgaggcagaggaatctgtgtcctcgaaactaaagcaagct
caagctgcttctgcaggggaaagaactgccaccacaatcacctccagtgaggaaactaat
acaaaatcagatcaagttgcaagtttaacacgcgcaactgaacaactctctcttggaaac
acaggctcacaacctagtgctactcagccaaaaagcgatgctgttggtgaagcagctgtc
ttaggccttgggattaacaattcagaaagtgagttcaaagcaatggctgctgatgtttct
gttttcacttttggagacgacgaagattatgaaagtgaatga

DBGET integrated database retrieval system