KEGG   Jatropha curcas: 105632819Help
Entry
105632819         CDS       T03922                                 

Definition
(RefSeq) double-strand break repair protein MRE11 isoform X1
  KO
K10865  double-strand break repair protein MRE11
Organism
jcu  Jatropha curcas
Pathway
jcu03440  Homologous recombination
jcu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    105632819
   03450 Non-homologous end-joining
    105632819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:jcu03032]
    105632819
   03400 DNA repair and recombination proteins [BR:jcu03400]
    105632819
DNA replication proteins [BR:jcu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     105632819
DNA repair and recombination proteins [BR:jcu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     105632819
    BRCA1-C complex
     105632819
   NHEJ (non-homologous end-joining)
    MRX complex
     105632819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 105632819
NCBI-ProteinID: XP_012070662
LinkDB All DBs
Position
Unknown
AA seq 728 aa AA seqDB search
MGDLPREDIPNTLRVLVATDCHLGYMEKDEIRRHDSFQAFEEICSIAEQKQVDFLLLGGD
LFHENKPSRSTLVKAIEILRRHCLNDRPVQFQVVSDQTVNFANTFGHVNYEDPHFNVGLP
VFSIHGNHDDPAGVDNLSAVDILSACNLVNYFGKMVLEGSGVGQITLYPILIRKGSTAVA
LYGLGNIRDERLNRMFQTPHAVQWMRPESQEGRQLSDWFNILVLHQNRVKTNPKNAINEH
FLPRFLDFIVWGHEHECLVDPQEVPGMGFHITQPGSSVATSLIDGESKPKHVLLLEIKGN
QYRPTKIPLTSVRPFEYAEVVLKDEADIDPNDQNSILEHLDKVVNNLIEKSNRKAVSRSE
LKLPLVRVKVDYSGFMTINPQRFGQKYVGKVANPQDILIFSKASRRGQSHAKIDDSERLR
PEELNQQNIEALVAESNLKMEILPVNDLDVALHNFVNKDDKMAFYSCVQYNIQETRNKLA
NDSDATKFEEEDIILKVGECLEERVKKRSVHSKDALQFTSSAHSMEDFRSATAAGIASAV
SFSDEEETEQVSGSRTSGRKQKGSRVVSRSLAASEAGKGKTSTRGRGRGRGRGSSNLKQT
TLDAALGFRQSQRSASVAATAAVRSIADEDENVDSASSEDAENNRINEVEDSSDDGGSIQ
GKGRKRGASRGRGKAAAPSKRGRKSDNSTIQRMLMGKDDDDDDDDDDVAKRLNKSQPRVA
RNYGALRR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggagacttgccaagggaggatattcctaatacacttagggtacttgttgcaactgat
tgccatctgggctatatggagaaggatgaaataaggcggcatgattcttttcaggcattt
gaagagatatgctcaatcgctgagcaaaagcaggtagacttcttactccttggtggtgac
cttttccatgaaaataagccctcaaggtcaacattggtcaaggccattgagattctccgt
cgtcattgtctcaatgatcgacctgtgcagttccaagttgttagtgaccagactgtgaat
tttgcaaatacattcgggcatgtaaattatgaagatccccactttaatgttgggttgccg
gtgttcagtatccatggaaatcatgatgatcctgctggagtggacaacctttcagcagtt
gatattctttcagcatgtaatcttgtgaactacttcgggaaaatggttctcgagggttct
ggagttggtcagatcacgctctatcctatccttattagaaagggctcaactgctgtagct
ctctatggtcttgggaacattagagatgaacgactcaatagaatgtttcagacaccacat
gctgtgcaatggatgagacctgaatctcaagaaggtcgtcagctgtctgactggttcaac
attctggtacttcatcagaacagagtgaagacaaatccaaaaaatgctataaatgaacac
tttcttccacgattcctggacttcattgtgtggggacatgagcatgaatgtcttgttgat
cctcaggaagttcctggaatgggatttcacatcactcaaccaggttcttcagttgcaaca
tcactaatcgatggagaatcaaagccaaagcatgtgcttcttctagaaattaagggaaat
cagtatcgcccaaccaaaatacctttgacttcagtgaggccttttgaatatgcagaggtc
gtgttgaaggatgaagctgacattgatcccaatgatcagaactcaattcttgaacatttg
gataaagtggtcaataatctaatagagaaatctaatagaaaggcagttagcagatcagag
ctcaagcttccattagttagagtgaaggttgattactctggatttatgaccataaatcct
caaagatttgggcagaagtatgtggggaaggttgcaaatcctcaagatattcttatattc
tccaaggcttctaggagggggcagagtcacgctaaaattgatgattctgagcgccttcgc
ccagaagagctaaatcaacagaatatagaagctttagttgctgaaagtaatctgaagatg
gagattcttccggtcaatgatttggatgttgcattgcacaattttgttaataaagatgac
aaaatggcattctattcttgtgtgcaatacaatattcaagaaacacgtaacaaacttgca
aacgattcagatgccacaaagtttgaagaggaagatataattcttaaagttggagaatgt
ttggaggaacgtgttaagaaaaggtccgtgcactctaaggatgctctacaattcacatcc
agtgcacattccatggaggattttagaagtgcaactgctgctggaattgcaagtgcagtt
tcttttagtgatgaagaagaaacagaacaggtatctggctcaaggacctccggtagaaaa
cagaaagggtcgagggtagtttctagatctttagctgcttcagaagctggaaaaggtaaa
acttctacaagaggaaggggcaggggcagaggcagaggctcaagtaacttgaagcaaaca
actcttgatgcagctcttggatttcgtcagtctcaaagatctgcatctgttgctgcaaca
gctgcagttagaagtattgctgatgaggacgaaaatgtggattctgcttcaagtgaagat
gctgagaataatagaatcaatgaggttgaggacagttcggatgacggtgggagcattcaa
ggcaaagggcgcaaaagaggtgcttctaggggaagaggtaaagctgctgcaccatcaaag
cggggaaggaaatcagataactcaaccattcaaagaatgcttatgggcaaggatgacgac
gacgacgacgacgacgatgatgtggcaaagagattaaacaagtctcaacctcgggtagcg
aggaactatggagctttaagaaggtaa

DBGET integrated database retrieval system