KEGG   Jatropha curcas: 105634194Help
Entry
105634194         CDS       T03922                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
jcu  Jatropha curcas
Pathway
jcu00250  Alanine, aspartate and glutamate metabolism
jcu00410  beta-Alanine metabolism
jcu00430  Taurine and hypotaurine metabolism
jcu00650  Butanoate metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Module
jcu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105634194
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105634194
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105634194
   00430 Taurine and hypotaurine metabolism
    105634194
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105634194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC GST_C_6
Motif
Other DBs
NCBI-GeneID: 105634194
NCBI-ProteinID: XP_012072404
UniProt: A0A067KTE0
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MVLSKIASESDVSVHSTFASRYVRESLPRYKMPENSIPKEAAFQIINDELMLDGKPRLNL
ASFVTTWMEPECDKLIMDAMNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGCYVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKVTGWDTP
IHVDAASGGFIAPFLWPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGYEGYRNVMENCHQNAIVLKEGLEK
TGRFNIVSKDIGVPLVAFSLKDNSKHTEFEIADMLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVLDITKVLLELDMLPAKINAKLIVAAEQNNGKNGTVVVKKTAIETQR
EITTYWKNFVMAKKSNKNTIC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatctaaaatcgcttcagagtctgacgtttccgttcactccaccttcgcctct
cgctatgtccgggagtcacttccaaggtataagatgccggaaaactctatacctaaggag
gcggcgtttcagataataaatgatgagctgatgcttgatggaaagccaaggctgaatttg
gcatcttttgtgacgacctggatggagcctgaatgtgataagcttattatggatgccatg
aacaagaactatgttgacatggatgagtaccctgtcaccacggagcttcagaatcgatgt
gtaaacatgatagcacatttattcaatgctccattgggagaatcggaggcggcagtcggg
gtcggaacagtaggttcatcggaggctataatgctagcagggcttgcattcaagagaaaa
tggcaaaacaagagaaaagctgaaggaaaaccatatgacaagcccaacattgtaactgga
gccaatgttcaagtctgctgggagaaatttgcaaggtattttgaagtagaattaaaggaa
gtaaagctaagtgaagggtgctatgtaatggacccagtcaaggcagtagaaatggtagat
gagaacactatttgtgtagctgcaattttgggttctacacttaatggagaatttgaagat
gtgaagctattgaatgatttattagtagagaaaaataaagttacaggatgggatactcct
atccatgtggatgcagccagtgggggattcattgcaccatttttgtggccagagcttgaa
tgggactttagacttccattggtgaagagtattaatgttagtggacacaaatatgggctt
gtctatgctggtgttgggtgggttatttggaggagcaaagaagatttgcctgaagaactc
atttttcatattaactatcttggaactgatcaacccactttcactctcaatttttcgaaa
ggttcaagccaaatcattgctcaatattatcaactaatccgtctcggctacgagggatac
cgaaatgtgatggagaactgccaccagaatgcaatagtcctgaaagagggactagaaaaa
acaggacggttcaacatagtgtcaaaggacattggagttcctctagtggcattttcactc
aaggacaatagcaaacacactgagtttgaaatagctgatatgctacgtcgttttggatgg
attgtgcctgcctacacaatgccagcggatgctcaacacattacggtgcttcgcgtcgtc
attagagaagatttctcgcgcactctcgcggagcgccttgtgcttgatatcacgaaagtg
cttcttgaactggacatgctacccgccaagattaacgcgaaattgattgtcgctgctgag
cagaataatgggaagaacgggacggtggtggtgaagaaaaccgccattgagactcagagg
gaaattactacttactggaaaaattttgttatggccaagaaatctaacaagaacactatt
tgctaa

DBGET integrated database retrieval system