KEGG   Jatropha curcas: 105635703Help
Entry
105635703         CDS       T03922                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jcu  Jatropha curcas
Pathway
jcu00620  Pyruvate metabolism
jcu00710  Carbon fixation in photosynthetic organisms
jcu01100  Metabolic pathways
jcu01200  Carbon metabolism
Module
jcu_M00168  CAM (Crassulacean acid metabolism), dark
jcu_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
jcu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
jcu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    105635703
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105635703
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     105635703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 105635703
NCBI-ProteinID: NP_001295679
UniProt: A7UH66
LinkDB All DBs
AA seq 965 aa AA seqDB search
MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YEISAGYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK
SKKGDFADENSATTESDMEETFKKLVVQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNEELRFRADALHRSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERSRHLLTNGISDIPEEATFTNVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLGIGSYREWSEERR
QEWLLSELRGKRPLFGPDLPKTEEIADVLDTFHVIAELPPDNFGAYIISMATAPSDVLAV
ELLQRECRVKQPLRVVPLFEKLADLEAAPAAVSRLFSIDWYRNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKQYGVKLVMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAIIATK
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIEKDRKNLQMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEELWPFGERLRANYEETKHLLLQIAGHKDLLEGDPYLKQRLRLRDAYITTLNVSQA
YTLKRIRDPDYHVTLRPHLSKEYTESSKPAAELVKLNPMSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaagaatttggagaagatggtatcaatagatgcacagttgaggctattggct
ccacggaaagtgtctgaggatgacaagttagtggagtatgatgctctgctattggaccga
tttctcgatatattgcaggatttgcatggggaggatattagagaaacggttcaagagtgt
tatgaaatttcagccgggtatgaaaggaagcatgatccgcagaagctggaggaacttggg
aaagtgctaacgagtttggatcctggggattcaattgttgttacaaaatcattttctcac
atgcttaacttggccaacctggctgaagaagttcaaattgcatatagacgaaggactaaa
tcaaagaagggtgattttgctgatgagaactcagcaactacggaatcagacatggaagaa
acctttaagaagctagtggtacaactgaaaaaatcgccagaagaagttttcgatgctttg
aagaaccagactgtggatttagtcctaactgcacatcctacccaatctgttcgtagatct
ttgcttcaaaagcatgcaaggatacggaattgtttgactcagctgtatgctaaggatatt
actcctgatgataagcaggaacttgacgaagccttgcaaagggagattcaagctgcattt
cgcactgatgagatccgaaggactcctccaactccgcaagatgaaatgagagcaggaatg
agctacttccatgagaccatatggaagggtgtcccaaagttcttgcgtcgcgttgacaca
gctttgaagaatattgggataaatgaacgtcttccttataatgcccctctcatccaattc
tcttcttggatgggtggggatcgtgatggaaatcctcgagtaactcctgaagttacaagg
gatgtttgcttgctggctagaatgatggctgccaacttgtatttctcccaaatagaggat
cttatgtttgagttgtccatgtggagatgtaatgaagaacttcggtttcgtgcagatgca
cttcatcggtcatctaggaaagatgcaaaacactacatagaattctggaaacagatccct
ccaaatgaaccttatcgagttattcttggtgatgtgagggacaaactttataatacacgt
gaacgctctcgccatttattaaccaatgggatttctgacattcctgaggaagctactttt
actaacgttgaacagttcttggagcctcttgaactctgttacagatcactttgtgcttgt
ggtgatcggccaattgcagatggaagtcttcttgatttcctacggcaagtttctaccttt
gggctttcacttgtaagacttgatatacgacaggaatctgacaggcatactgatgtcctt
gatgctatcacaaagcatttgggaattggatcttatcgagaatggtccgaggaacgcagg
caggaatggctcttatctgagctcaggggcaagcgtcctctttttggccctgatcttccg
aaaacagaagaaattgctgatgtattagacacattccatgtcattgcagaacttcctcca
gacaattttggtgcttatataatctcaatggctacagcaccgtctgatgtgcttgctgtc
gagcttttgcagcgtgaatgccgagttaagcaaccattgagggttgttccattgtttgaa
aagcttgctgatcttgaagctgctccagctgctgtctctcgtcttttctcaatagattgg
tatagaaaccggatcaatgggaagcaagaagtcatgatagggtactcagattcaggaaaa
gatgctggtcgtctctctgctgcttggcaattgtataaagcccaagaagagcttgtgaag
gtggcaaagcaatatggggtcaagctagtaatgtttcatggccgaggagggactgttgga
agaggaggaggacccactcatcttgctatcttatctcaaccacctgacaccattcatgga
tcacttcgtgtgacagttcaaggtgaagttattgaacaatcttttggggaagaacacttg
tgtttcagaacactccagcgttttacagcggcaacgcttgaacatgggatgcatccccca
atctcgccaaaaccagaatggcgtgcactcttggatgagatggccattattgccactaag
gagtatcgttccatagtctttcaagaaccacgttttgttgaatactttcgccttgcaaca
ccagagttggagtatggtcggatgaatattggaagtagaccgtctaaaaggaaaccaagt
ggtggcatagaatcactccgagcaatcccctggatcttcgcatggactcagacaaggttt
catctaccagtctggcttggctttggtgcagcattcaagcacatcattgagaaggataga
aagaatcttcaaatgctccaggagatgtacaatcaatggcctttctttagggtcacaatt
gacttggttgagatggtgtttgccaaaggtgatccaggaattgcagctttatatgacaag
ctcctagtatcagaagaattgtggccatttggagagcgcttgagagcaaactatgaagaa
acaaagcacctgctgttacagattgctgggcataaagatcttctagaaggagacccgtac
ttgaagcaaaggcttcggctccgtgatgcctatattacaactctaaatgtgtcccaagct
tacactctgaagcggatccgtgaccctgattaccatgtgacattgaggccacacttatca
aaagaatatacggaatcaagcaaaccagctgcagagcttgtaaagctcaatcctatgagt
gaatatgcacctggtctagaagacaccctcattttgaccatgaagggcattgctgctgga
atgcaaaataccggttaa

DBGET integrated database retrieval system