KEGG   Jatropha curcas: 105636816Help
Entry
105636816         CDS       T03922                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
jcu  Jatropha curcas
Pathway
jcu00052  Galactose metabolism
jcu00500  Starch and sucrose metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105636816
   00500 Starch and sucrose metabolism
    105636816
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105636816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105636816
NCBI-ProteinID: XP_012075558
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MERNKNMNKPARSHSHHLLLLLLFFFFTFLIPLSQEQELNDTVGYGYVIESVVVSLPDRS
LKADLSLIKNSTVYGPDIQSVSLFASFETKERIRIRITDSQAQRWEIPQEIIPRQDHHIS
LVNYVKNPPASHRALLENKILSSPNSDLVFTLRDTTPFGFSVSRKSNGDVLFDAMPDTAD
PGSFLVFKDQYIQLSTSLPAIRSSIYGLGEHTKSSFKLKPKETLTLWNADLASANLDMNL
YGSHPFYIDVRSPSDDGRVPAGSSHGVLLLNSNGMDIIYSGDRISYKVIGGIIDLYIFAG
ASPDSVIQQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLEAVVAGYAKAGIPLEVMWTD
IDYMDAYKDFTLDPINFPAGLMKQFVHKLHQNAQKYIVIVDAGLGVNDTYETYKRGIESD
VFIKRDGVPYLGEVWPGQVYFPDFLKPNTTIFWMNEIKQFLDILPVDGIWLDMNEISNFI
TSPPTPFSTLDDPPYKINNAGIRRPINNKTIPATCLHFGNITEYDAHNLFGLLEARATHE
ALINVTSKRPFVLSRSTFVSSGKYAAHWTGDIASTWEDLANTIPTMLSFGLFGIPMVGAD
ICGFSGNTTEELCRRWIQLGAFYPFARDHSEKNSIRQELYLWDSVASVAREALGLRYRLL
PYLYTLMYEAHSKGTPIARPLFFSFPEDTNTYAINSQFLIGKGVMVSPVVTAGATTVDAY
FPRGNWFSLFNYLNSVSVNSGSYVTLDAPSDHINVHIREGTILAMQGEAMTTKMARKTPF
ELLVVVSSNGNSTGELFLDEGEEPEMGGSNGDWSFLRFYGGKIGNDTVFVASEIVNGEFA
SSEKWFVDKVSFIGLEKANGLKAHDQLRITKGTMLNGNPVVKGYLDDNLEFLVIEISRLS
LLIGKEFKLELKLY
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaacaaaaatatgaacaaaccagcaagatctcactctcatcatctcttacta
ctgctacttttcttcttcttcacatttctaattccattatctcaagaacaggagctaaac
gacaccgtaggctacggctacgtgattgagtctgtcgtcgtcagtttaccagacaggtca
ttaaaagctgaccttagccttatcaagaattccacagtttatggtcctgatattcagagt
gtaagcctttttgcaagctttgaaacaaaggagagaatcaggattcgaataaccgattca
caagctcaaagatgggagattccacaggaaatcattcctcgacaagatcaccatatctcg
ctcgtaaattacgtcaaaaatcctccggcgagtcaccgtgctctgctggaaaacaaaatc
ctctccagcccaaactccgatctcgttttcacgcttcgcgacaccacgccgtttggcttt
tctgtgtcacgcaaatccaatggcgacgttctttttgacgcgatgccagacacggcggat
cccggcagtttcttagttttcaaggatcagtatattcaactctccacttcacttcctgca
attaggtcttcaatctatggtttaggagagcatacaaaaagctccttcaagttgaagcca
aaagaaacgttgactttgtggaatgctgacctggcaagcgcgaatctcgatatgaatctt
tatggttctcatccattttacattgacgtccgatcgccgtccgatgatggtagagtaccg
gcggggagtagccatggagttttactgttgaatagtaacggaatggatataatttacagc
ggtgataggataagttataaggtaattggtggtataattgatttgtacattttcgctgga
gcttctcctgattcggtgatacagcaatacacggagcttattggcaggcctgcgcccatg
ccttattggtcatttggatttcatcaatgtcgatatggttacaagaatgtgtccgatctt
gaggcagtggttgctgggtatgcaaaagctggtatacctcttgaagttatgtggacagat
attgattacatggatgcatataaagattttactcttgatccaatcaactttcctgctggt
ttaatgaaacaatttgttcacaaacttcaccagaatgctcaaaaatacattgtcattgtg
gatgctggtcttggtgtaaatgatacctatgaaacctataaaagggggattgaatctgat
gtctttattaaacgtgatggtgttccttacttgggagaagtttggcctggacaagtttat
ttcccagattttcttaaaccaaacaccacaatcttttggatgaatgaaatcaaacaattt
ttagatattcttccagttgatggtatttggctagacatgaatgagatatccaatttcata
acttcaccaccgaccccattttccacccttgatgatcctccttacaaaattaacaacgct
ggaatccggcggccgattaataataagacaataccggcaacatgtttacattttggtaac
attacagaatatgatgctcataacttgtttggattgctagaagcaagagcaactcatgaa
gccttaataaatgtgactagcaagaggccttttgtactttctaggtctacttttgtaagt
tccggcaaatatgcagctcattggactggtgatattgcctccacatgggaagatttagct
aataccattcctactatgttgagttttggactatttggaattccaatggttggtgctgat
atttgtggtttttctggaaatactactgaagaactttgtcgacgttggattcagcttggg
gcattttatccatttgcgcgagatcactcagaaaagaactctattcgtcaagaactctat
ctttgggattcagtagcttcagtggccagggaggctttagggcttcgatatcgactgctt
ccgtacttgtacacattaatgtatgaagcgcattccaaaggaacacccatagcaaggccc
ttatttttctcatttcctgaggacaccaacacttatgcaatcaactcacaatttctgatt
ggcaaaggtgtaatggtctcaccagtggtaacagccggagcaactacagttgatgcatat
tttcctcgagggaattggtttagcctatttaattacttgaactcagtcagtgtaaattca
ggaagttatgttacattagacgcgccatctgatcacattaatgtgcatataagagaaggt
actattttggctatgcaaggggaagcaatgacaacaaaaatggctcgaaagacgccattc
gagctcttggtggttgtgagtagcaacggaaatagcacaggagaactatttttagacgag
ggagaggagccagagatgggaggatccaatggggactggagttttctcagattttatggt
ggaaagatagggaatgatactgtctttgttgcatcagaaattgtgaatggagaatttgct
tcgagtgaaaaatggtttgtagataaggtgagtttcataggtttggaaaaggccaacgga
ttgaaagcacatgatcagctacgcatcacaaaagggacaatgctgaatggcaaccctgta
gtaaagggttatttggatgacaacttggagtttcttgtgattgaaatatcacgattatca
cttcttataggaaaagagtttaagttggagttaaaactttattga

DBGET integrated database retrieval system