KEGG   Jatropha curcas: 105637848Help
Entry
105637848         CDS       T03922                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
jcu  Jatropha curcas
Pathway
jcu00010  Glycolysis / Gluconeogenesis
jcu00051  Fructose and mannose metabolism
jcu00052  Galactose metabolism
jcu00500  Starch and sucrose metabolism
jcu00520  Amino sugar and nucleotide sugar metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
Module
jcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
jcu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105637848
   00051 Fructose and mannose metabolism
    105637848
   00052 Galactose metabolism
    105637848
   00500 Starch and sucrose metabolism
    105637848
   00520 Amino sugar and nucleotide sugar metabolism
    105637848
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105637848
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:jcu04131]
    105637848
Enzymes [BR:jcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105637848
Membrane trafficking [BR:jcu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105637848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 105637848
NCBI-ProteinID: XP_012076877
UniProt: A0A067KC63
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCSAAVCAAAALIVRHRMQSSGRWARAMAILREFEEKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVIRVLLGGREDR
VVKQEFEEVSIPPHLMTGSSDALFDYIAEALAKFVATEGEGLHPSPGQQRELGFTFSFPV
RQTSIASGTLIKWTKGFSIEDTVGQDVVGELTKAMERVGLDMRVAALVNDTIGTLAGGRY
YDQDVIAAVILGTGTNAAYVERAQAIPKWHGLLPKTGEMVINMEWGNFRSSHLPLTKYDQ
ALDDDSLNPGEQIFEKTISGMYLGEIVRRVLVEMAEEAAFFGDVVPSKLKIPFILRTPDM
SAMHHDTSSDLRVVGSKLKDILEIPNTSLKMRKVIVELCGIVASRGARLSAAGIAGVLKK
LGRDTVKDGEKQRSVIALDGGLFEHYTKFRVCMESTLKELLGEEVSESIVIEHSNDGSGI
GAALLAASHSQYLDVAES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggtggcggtgggagcggcggttgtctgctcggctgctgtttgtgcggcggcg
gcgctgatagtcaggcacaggatgcagagctctggtaggtgggccagggctatggcgata
ctaagagaattcgaggagaagtgtgggactccgattgggaagctacgccaagtggccgat
gctatgactgtggagatgcatgcaggtcttgcatcggaaggtggaagtaagcttaagatg
ctcatcagctacgttgacaatcttcccactggagacgagaagggattgttttatgcattg
gaccttggtggcacaaattttcgtgtcatacgggtactattgggtgggagagaagatcga
gttgtcaaacaagaatttgaggaagtttcaattcctccacacttgatgactggatcatca
gatgcattatttgattatatcgctgaagcactcgccaaatttgtagctacagaaggtgaa
ggtttgcatccttcacctggtcaacaaagggaattgggctttaccttctcatttccagtt
aggcaaacatcaatagcatcaggaactcttataaaatggacaaaaggcttctccatagag
gacacggttgggcaagatgtggtgggagaactgacaaaagccatggaaagagttggactt
gacatgcgtgtggcagctttggtcaatgatacaattgggacattagctggaggtagatac
tacgaccaggatgttattgctgctgtaatcttggggactggaacaaatgctgcatatgta
gaacgagcacaagcaattcccaagtggcatggtcttctaccaaaaactggagaaatggtt
atcaacatggagtggggtaactttcggtcgtcgcacctaccattgacaaaatatgatcaa
gccctggatgacgactctctgaatccaggggaacagatttttgaaaagactatttctggt
atgtatttgggagaaatagtacgcagagtcctagtggaaatggctgaggaagctgctttc
tttggtgatgttgttccatcaaaactgaagattccatttattttaaggactccagacatg
tctgcaatgcatcatgatacgtcttcagatctgagagttgtcggaagcaaactaaaagat
atcttagagatacctaatacctccctgaaaatgagaaaagttattgttgagctctgtggc
attgttgcctctcgtggtgcccgcctatctgctgctggaattgcaggcgtcctaaagaaa
ttgggaagggatacagtgaaggatggggaaaagcagaggtcggtaatagcattggatggt
gggttgtttgagcactacactaaattccgtgtctgcatggagagcactctcaaggagttg
cttggagaggaagtttctgagagcattgtaattgagcactcgaatgatggctctggcatt
ggagcagccctcctggctgcctcccactcccaatacctagatgtggcagaatcttga

DBGET integrated database retrieval system