KEGG   Jatropha curcas: 105638439Help
Entry
105638439         CDS       T03922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
jcu  Jatropha curcas
Pathway
jcu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105638439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:jcu03036]
    105638439
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105638439
Chromosome and associated proteins [BR:jcu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105638439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 105638439
NCBI-ProteinID: XP_012077634
UniProt: A0A067KB37
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MGSVVPFQDLNLSPSPSSSPPSTNAAAAAVLPPPPALLIPKIEPKLEPLDSLVETPQEPQ
DPLFPDFTPNFFSNSEHTPPSQSSVLSSSDEDNVYSEYHRISELFRTAFAKRLQEQYGDV
SVLDPDSRAIVPVNEDTTVSSVVVAKPHRKYAKRSSELVRVTDLGIEDQRYFRDVVRRTR
MLYDALRIISVLEEEKRRGEALGRRARGDLLAAAVMRERGLWLNRDKRIVGSIPGVEVGD
LFFFRMELCVVGLHGQVQAGIDYLPASQSSNREPIATSIIVSGGYEDDEDSGEMLIYTGH
GGQDKFSKQCSHQKLEGGNLALERSMHYGIEVRVIRGFKYTGSFTNKIYVYDGLYKIHDC
WFDVGKSGFGVYKYKLLRMDGQPEMGSSILRFAQSLKANPLSVRPRGYLSLDISNKKENM
PVMLFNDIDNDHDPLCYEYLVRTVFPAFAINHGSNGTGCDCVSGCTDGCFCSMKNGGEFA
YDQNGFLLRGKPVVFECGSFCRCPPGCRNRVTQRGLRNRLEVFRSRETGWGVRSMELIHA
GAFICEYAGVVLTREQAQVFTMNGDSLIYPNRFSQKWAEWGDLSQIYSDYVRPSYPSLPP
LDFAMDVSRMRNVACYMSHSSTPNVLVQFVLYDHNNLMFPHLMLFAMENIPPLRELSLDY
GVADEWTGKLSICN
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgggatctgttgtcccatttcaagacctcaatctctctccatctccatcgtcatctccg
ccgtcgaccaacgctgctgctgctgccgtccttcctccaccgcctgctcttttaatcccg
aaaattgaaccgaaacttgagccgcttgatagtcttgttgaaacgcctcaggaacctcaa
gatccattatttcccgattttacccctaactttttctctaattccgaacatacccctcct
tctcaatcctctgttctctcttcctctgatgaagacaatgtctactccgaataccacaga
atctcggagcttttccgtactgcgtttgcaaaacgcttacaagagcaatacggtgacgtt
tccgtgttagacccagattctcgcgcgatcgttcctgtaaatgaagacactaccgtctct
tccgttgtcgtcgctaagcctcatcgcaaatacgctaagcgctcatcggagctcgtccgt
gtcactgacctcggaatcgaggaccaacgatatttccgcgacgtcgtgcgcaggacacgt
atgctgtacgacgcacttcgtatcatttctgttttagaggaagagaaacgacgtggtgag
gccctcggccgccgtgcccgaggcgatctccttgctgctgccgttatgcgtgaacgtggg
ctgtggcttaatcgtgacaagagaattgtggggtccattcctggagttgaagttggggat
cttttctttttcagaatggaattgtgtgttgttgggcttcacggacaagttcaagcagga
attgattaccttccagcaagtcaaagctcgaatagggagcccattgctacgagtattatt
gtttcgggtggttatgaagatgatgaggattctggtgaaatgttgatatatacaggacat
ggtggtcaggataagttctcgaagcaatgctcgcaccagaagcttgaaggagggaatttg
gcgttggagaggagtatgcattatgggattgaggtaagagtgattagagggtttaaatat
acaggaagttttacaaataagatttatgtttatgatgggttgtataagattcatgattgt
tggtttgatgtggggaaatctggatttggcgtttataagtacaagctattgaggatggat
gggcaaccagaaatgggtagttctattttgaggtttgcacagagtttgaaagctaatcca
ttgagtgtaaggcctaggggatatcttagtcttgatatttcgaataagaaggagaatatg
ccagttatgttgtttaatgatattgataacgaccatgatcctctgtgttatgagtatttg
gtgaggactgtgtttcccgcctttgcgattaatcatggaagtaacgggacagggtgtgat
tgtgtttcaggttgtactgacggttgtttttgttcgatgaagaatggtggggagtttgct
tatgatcagaatgggttcttgttgagaggaaagccggtggtatttgaatgtggatctttt
tgtaggtgccctccgggctgcaggaaccgggtaactcaacgggggctgagaaatagattg
gaagtgtttaggtcaagggaaacaggttggggagttaggtcaatggaattgatacatgcc
ggtgcatttatatgtgaatatgctggggttgttcttacaagagagcaagcacaagttttc
acaatgaatggtgatagtttaatttatccaaatcggttttcccagaaatgggcagaatgg
ggtgatttatctcagatatattctgattatgtgcgtccatcttatccctcacttccacca
ttggattttgcgatggatgtctcaagaatgcggaatgttgcttgttatatgagccacagt
tcaactccaaatgtgctggtgcaatttgttctgtatgatcataacaatttgatgttccca
catctcatgctttttgcaatggagaacattcctccattgagggagctcagccttgattat
ggtgtggctgatgaatggacggggaagctttccatttgcaactga

DBGET integrated database retrieval system