KEGG   Jatropha curcas: 105638786Help
Entry
105638786         CDS       T03922                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
jcu  Jatropha curcas
Pathway
jcu03030  DNA replication
jcu03410  Base excision repair
jcu03420  Nucleotide excision repair
jcu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105638786
   03410 Base excision repair
    105638786
   03420 Nucleotide excision repair
    105638786
   03430 Mismatch repair
    105638786
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:jcu03032]
    105638786
   03400 DNA repair and recombination proteins [BR:jcu03400]
    105638786
Enzymes [BR:jcu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105638786
    6.5.1.6  DNA ligase (ATP or NAD+)
     105638786
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105638786
DNA replication proteins [BR:jcu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105638786
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105638786
DNA repair and recombination proteins [BR:jcu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105638786
   NER (nucleotide excision repair)
    Other NER factors
     105638786
   MMR (mismatch excision repair)
    Other MMR factors
     105638786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105638786
NCBI-ProteinID: XP_012078043
UniProt: A0A067K9W0
LinkDB All DBs
Position
Unknown
AA seq 1417 aa AA seqDB search
METSTCSSKPPQTLDSLQLYQTSLASLSVPIHSDHRHHLSSFPLPSSLPSSKVIPNTRFL
VDAFRYATSSTVTYFLSHFHSDHYTGLSSNWCQGLIFCSPTTANLLTQVLKIPSQFVFPL
PLREPVIIDGSEVTLIDANHCPGAVLFLFKVPGKNQASFKMYIHTGDFRYCGSMQEDSLL
SQFFGCDTVFLDTTYCDPKFVFPSQEESIDYIVGVIDRIGEKYMGQERTVLFLVATYVVG
KERILLEIARRCKRKVHVDGRKMEVLRVLGHGESGMFTEDETESDVHVVGWNVLGETWPY
FRPNFVKMKEIMVERRYSKVVGFVPTGWTYEATHKKNFPVRSKETFEIHLVPYSEHSNYD
ELMGFVKFLRPKRVIPTVGVDIEKLDSKAAIKMQKHFAGLVDEMANKKEFLMGFHRGSLE
NDEKVEMEDVSGLSEGLGQEKGAASCEVNTLEDKDLGVILNSSTILQECGSNLAILNDEG
TKKIIQELSDCLPSWVTRDQMLDLINNSEGNFVDAVSNFYDNETQFHQQVFKRKASISSS
HNISISSSPASIPNGPEALSKPVSIKSSQESLSSPLSQNLKSSNTKPSVKSRITPAKRKN
VENKHRKKVKPNPKLESGGPKQSTITRFFNKIVPKVSTGSVVEFIPEQCPVDEKSLPNDD
TISYKQEINQFIQIIDGNNSLRGYAATMLERTKGDISKALDIHYGNPEGNFDKSVVRLVA
SGDSIQPQCHTNEFSSAQEKTVSEEEEHMIDLSLKRALTGNVAPTYVALPPEKYIPIQHA
CWKAGEPAPYIHLARTFDLAEAEKGKIKATSMLCNMFRSLLALSPEDVLPAVYLCTNKIA
ADHENIELNIGGSLVTSAIEEACGTNRSKIRDMYNSLGDLGDVAQLCRQTQTLLAPPSQL
LIKDVFSVLRKISAQTGTGSTAQKKSLIVNLMRSCKEKEMKFIVRTLVRNLRIGAMMKTV
LPALAQAVALNSLANASEEQKVDLKEKLQYLSAAVVEAYNILPNLDLVIPSLISRGIEFS
SSTLSMVPGVPIKPMLAKITNGISQALKLFEDKAFTCEYKYDGQRTQIHKLSNGTVRVFS
RNGDETTSRFPDLVNIIKESCKPGAVTFILDAEVVAVDRKNGCKLMSFQELSSRERGSKD
SSITVNNIKVNICVFVFDIMFANGEQLLELPLRQRRKYLKDLFCDERMGYFEYAKEITIE
AHDACLTNDVTIVKIHSFLEESLHSSCEGIMLKSLDVNAEYSPSKRTDTWLKVKRDYVEG
MNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPENEEFQSVCRVMSGISDAFYIEMKEFF
SGERVLSKKPPYYQTNEVPDLWFSPELVWQIRGADFTVSRVHHAAIGLIHASRGISIRFP
RFISSVSDRNPEDCSTAADVAELFNSQTRKMDVAAAN
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atggaaacctcaacatgttccagtaaaccaccgcaaaccctagattctctccagctctac
caaacatctctcgcttccctttccgtcccaatccatagcgaccatcgccaccacctctcc
tccttccctctcccgtcgtctcttccttcgtcgaaggtcatccccaacactcgcttcctc
gtcgacgcatttcgctatgccaccagctccacagtcacctacttcctctcccatttccac
tctgatcactatacaggcctttcctctaattggtgccaaggcctcattttctgttcccct
accactgctaatctccttactcaagttctcaagattccttcgcagttcgtctttccattg
cctttgcgcgagcctgtgattatcgatgggtctgaagttacacttatcgatgccaatcac
tgccctggggctgttctgttcttgtttaaagttcctggtaagaatcaagcgagttttaag
atgtatattcatactggtgattttagatactgtggttcaatgcaagaagatagcttactg
agccagttttttggttgcgacacagtgtttttagatactacttattgtgatcctaaattt
gtttttccctctcaagaggaatcgattgattatatagttggtgtgatagatagaatagga
gagaagtatatgggtcaagaaagaactgtactgtttctcgttgcaacctatgttgtaggg
aaggagaggattttgcttgagattgcacgtaggtgtaaaagaaaggtccatgtggacggg
aggaaaatggaggttttgcgggttttaggacatggagagagtgggatgtttacagaagat
gagaccgagagtgatgttcatgttgttggatggaatgtgcttggagagacatggccttat
tttcggccaaattttgttaaaatgaaggagattatggtggaaagacgatattctaaagtt
gtgggatttgtacctactggttggacttatgaagcgacacataaaaaaaacttcccagtg
aggtcaaaggagacatttgagatccatctcgtgccatatagtgaacattcaaattatgat
gagcttatggggtttgtgaaattcttgagaccaaagcgtgttattcctacagttggtgtg
gatattgaaaaacttgacagtaaagctgctattaaaatgcagaagcattttgctggttta
gttgatgaaatggctaacaaaaaagagtttttaatgggttttcatcgtgggtctttggag
aatgatgaaaaggttgagatggaagatgtctctggcttgagtgagggcctaggtcaggag
aaaggggcagcttcctgtgaagtcaatacgcttgaagataaggatctaggtgtcattttg
aactcttcaactatcctgcaagaatgtggttcaaatttggccatactaaatgatgaggga
acaaagaagatcatacaagaacttagtgattgtttgccttcatgggttacccgagaccaa
atgttggatttgattaacaactcagaagggaattttgttgacgcagtgtctaatttttat
gataacgaaacacaatttcatcaacaagtctttaaacgaaaggcatcaatttcctcatct
cataatatatctatttcttcatctccagccagtataccaaatgggcctgaagcactttca
aaaccagtttctattaagagtagccaagagagtttgagttctccattgagtcaaaatctt
aaatcatcaaacacaaagccttcagttaaaagtcgcataacccctgcaaaaaggaagaat
gttgaaaataagcacaggaagaaagtaaaacctaatccaaaacttgaatctgggggacca
aaacagtctactattacaaggttcttcaataagattgtgcctaaggtttctacaggcagc
gtggttgagtttataccagagcaatgtccagtagatgaaaaatcattgccgaatgatgac
actatatcatacaaacaggagataaatcagtttattcagatcattgatggtaacaattca
ttaagaggctatgctgccaccatgctggagaggaccaaaggagacattagcaaggcatta
gatatacattatggtaatccagagggtaactttgacaagagtgtggtgaggttggtagcc
tcaggtgattcaatccagccccagtgtcacactaatgagttctcttctgctcaggaaaaa
actgtttcggaggaggaagaacatatgattgatttgtctctgaagagagcattgacagga
aatgtggctccaacttatgttgcactacctccagaaaagtacattcctatacagcatgca
tgctggaaggctggagagcctgctccatatatccatcttgcacgaacatttgacttggct
gaggctgaaaaaggaaagatcaaagctacttctatgttatgcaatatgtttagaagttta
ctagcgttgtctcctgaggatgtcctacctgctgtgtatctatgcaccaataagatcgct
gctgaccatgaaaatatagagctgaacataggtggaagcttggtcacatcagcaatagaa
gaggcatgcgggacaaacaggtccaaaataagggatatgtacaacagtttgggggatctt
ggtgatgttgctcaactatgccgacaaacacaaacattacttgctcctccttctcaactt
cttattaaagatgttttttccgtgcttcgaaagataagtgcgcagacaggtactggaagc
actgctcagaagaagagcctcattgtaaatcttatgcgttcttgtaaggagaaggagatg
aagtttattgttagaactttggtaaggaatttacggattggagcaatgatgaaaactgtt
ctacctgcactggcccaagctgttgctctgaattccttggctaatgcttctgaggaacag
aaagttgacttgaaggagaaacttcagtacctttctgcagcagttgttgaagcttataat
atacttccaaatttagatttggtcattccttcacttataagcagaggcattgaattttct
tcatccaccttgtcaatggtgccaggagtacctattaaacctatgcttgcaaaaattaca
aatggaatttctcaagcattgaaactctttgaagataaagcttttacatgtgaatacaaa
tatgatggtcagcgcacccaaattcacaaattatcaaatggtacggtgcgtgtcttttca
cgaaatggggatgaaacaacatcaagatttccagatttggtgaacataattaaggaatct
tgtaaacctggtgcagtgactttcattctggacgcagaggtagttgcagttgatagaaaa
aatggctgcaagcttatgtctttccaagaactatcatcaagggagagagggagcaaagat
tcatcaataacagtgaataacataaaggtcaacatttgtgtatttgtctttgatatcatg
tttgctaatggagaacagttgctggagcttcctctccgccaaagacggaaatacctaaag
gatttgttttgtgatgaaaggatgggctattttgaatatgcaaaggaaattacgattgaa
gcacatgatgcttgtttgaccaatgatgtaacaattgtcaagatacactctttccttgaa
gagtcattgcactcatcatgtgaagggatcatgctgaaatctttagatgttaatgctgaa
tattctccatcaaagcgtactgacacatggctgaaggttaaacgtgattatgtggaagga
atgaatgattctcttgatttagtacccattggagcctggcatgggaatgggagaaaagca
ggatggtatagtccatttctcatggcatgttacaaccctgagaacgaagaattccaaagt
gtatgccgtgtcatgtccgggatctcagatgcattttacattgagatgaaagaattcttt
tctggagagagagtcttgtcaaaaaagccaccatactaccaaactaacgaggtgccagat
ttgtggttttctccagaacttgtttggcaaatacgaggtgcagactttacagtttcacga
gttcaccatgctgctataggtttaattcatgcctcccgtggcatctcaatcagatttccc
agatttatcagctcagtgtcagatagaaatccagaggattgcagcacagctgcagatgtt
gcagaattgtttaattctcaaacacggaagatggatgtagcagctgcaaattga

DBGET integrated database retrieval system