KEGG   Jatropha curcas: 105639730Help
Entry
105639730         CDS       T03922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
jcu  Jatropha curcas
Pathway
jcu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105639730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:jcu03036]
    105639730
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105639730
Chromosome and associated proteins [BR:jcu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105639730
   Polycomb group proteins
    PRC2-EZH2 complex
     105639730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 105639730
NCBI-ProteinID: XP_012079259
UniProt: A0A067KAC2
LinkDB All DBs
Position
Unknown
AA seq 922 aa AA seqDB search
MASKASPSASASRSEPPKNSPMTKPQETSPTIKEILSVIDSLKKQLAVNRCVSIKKRMED
NEQKLLGVTNHLYTLSNERRNNWINITDGSIDLLTKRQKDALGMHSGIDMSNGDKDTSQE
DGHASTAVLLGSSIPVKSAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
DQNGGEALICSDSEEEIIDDEEEKRDFVDSEDYILRNTVKEVGSSDSVMESLAQCFSRSP
SEVEARYEVLTKAETAVEDPKNGETDAQTVNSFLDKDLEAALDSFDNLFCRRCLVFDCRL
HGCSQDLVFPAEKQHPWNHLDEENVPCGPHCYKSVLKSERVGIANSSEYGDIGENSVRPT
DGIVAHVTSRKKSSAQSARRKVKSSQSESASSNAKNVSESSDSEIGPQQDAISPSKTKLG
GKYGVCQRNSKRVAERVLSCMRKRQKKTVASDTDSVASGSLLPADMKLRSTSRKENEDAS
SSSCKNVKSVTTGRSRRKETTQDSNNLVQGEVHDDPPSEMITDPPATSSDDTLRKEEFID
ENVCKRELGDSKSWKAFEKSLFEKGIEIFGRNSCLVARNLLNGLKTCWEVFQYMNYSDNR
LACQAGDAANSLGEGYSKFDFNGSMSNNEVRRRSRFLRRRGRVRRLKYSWKSTAYHSIRK
RITERKDQPCRQYNPCGCRTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCR
SRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRS
DVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYR
KGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARK
PEASGSKKEDGAHTSGRAKKVA
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccgtctgcttccgctagcagatcggagcctcctaagaactct
ccgatgacaaaaccacaagaaacatctccaacaataaaagagattttatcagttattgac
tctttaaagaagcaacttgcagttaaccggtgtgtttcaataaagaaacgaatggaagat
aatgagcaaaagttgctcggcgtcacaaaccatctttatacattgtcaaatgaaagaaga
aataactggattaacataacagatggtagtatagatttactaacaaagaggcaaaaagat
gcacttggtatgcacagtggtattgacatgagtaatggagataaggacacttctcaagaa
gatggtcatgcttctacagcagtccttctgggatccagtattccagtcaagagtgctgtt
cgccctattaagctcccagaagtgaagagactacccccttacactacatggatttttttg
gacagaaatcaaagaatgacagaagatcaatcagtggttggtcgaaggagaatatattat
gatcaaaatggtggtgaagcacttatttgcagtgatagtgaggaggaaataattgacgat
gaggaggaaaagagagattttgtagattctgaagattatattcttcgaaatactgtcaaa
gaagttggttcatctgattcagtgatggaatcactggcacaatgtttttctagaagccct
tctgaagttgaggcaagatatgaagttcttacaaaagcagagacggctgtggaggatcca
aaaaatggagaaactgatgcacaaacggtgaattcttttcttgacaaggatcttgaagct
gctttggattcttttgacaacctattttgccgtcgatgtcttgtctttgattgcagattg
catggatgctcacaggatcttgtctttcctgctgagaaacaacatccatggaaccatcta
gatgaggaaaatgtaccatgtggtccacactgttataaatcggttttgaagtcagaaaga
gtgggtattgcaaattcttctgagtatggtgacattggagagaattctgtccgtccaact
gatgggattgtggcacacgttacttcaaggaagaagtcttctgctcaatctgccagaagg
aaagtaaagtccagccaaagtgaaagtgcttcgtcaaatgcaaaaaatgtttcagagagc
agtgattcagagattggacctcagcaggatgccatttcaccctccaagactaagcttggt
ggaaaatatggggtttgtcagaggaacagcaaacgagtggctgaacgtgttctgagttgc
atgcggaaaaggcagaagaaaacagtagcctctgatactgactctgttgctagtggaagc
cttttgcctgctgatatgaagcttcggtctacttcgcgtaaagaaaatgaagatgctagt
tcttcttcctgtaagaatgttaaatctgtgacaactggaaggtctaggaggaaggagaca
actcaggatagtaacaacttggttcaaggtgaagttcatgatgatcctccaagtgagatg
attactgatccacctgcaactagtagtgatgacactttgaggaaagaagagttcatagat
gaaaatgtatgtaaaagagagctgggtgatagcaaatcttggaaagcttttgaaaaaagc
ctatttgagaaaggtatagagattttcggacggaacagttgtttagttgcgaggaacctt
ttaaatggtttaaagacttgttgggaggtcttccaatatatgaattactctgacaatcgg
ctggcctgccaagcaggtgatgctgcaaattctcttggtgaaggatattccaagtttgac
ttcaatggatcaatgagtaacaatgaagtaagaagaagatcaagatttttacgcagaaga
ggaagagttcgccgcttgaagtattcttggaaatctactgcttatcattctattaggaag
cgaattactgaaagaaaagatcagccatgccgccaatataacccatgtggttgcagaaca
gcttgtggaaagcagtgttcctgtctgttgaatggcacatgctgtgagaagtactgtgga
tgtccaaagagttgcaagaaccgatttaggggctgtcattgtgctaaaagtcaatgtcga
agtcgtcaatgtccatgctttgctgcagacagagaatgtgatccagatgtttgtcggaat
tgttgggtcagttgcggtgatggtactcttggggttcctaaccaaagaggtgacaattat
gaatgtaggaatatgaagcttcttctcaaacaacagcaaagggttttacttggaagatcc
gatgtgtctggttggggagctttcttgaagaatagtgttggtaagcatgaatatctaggt
gaatacactggagagctgatttcacacagggaagcagataagcgtgggaagatatatgac
cgtgaaaattcatcttttctcttcaatctgaatgatcagtttgtccttgatgcttaccga
aaaggtgacaaattgaagtttgccaaccactcaccagatccaaattgctatgcaaaggtc
ataatggttgcaggggatcatcgggtgggcatatttgccaaagaacggattagtgcggga
gaagaacttttctatgattatcgttatgaaccagacagggcgcctgcttgggctaggaag
cctgaagcaagcggatcgaaaaaggaagatggggctcatacaagtggccgtgctaaaaag
gttgcttag

DBGET integrated database retrieval system