KEGG   Jatropha curcas: 105640404Help
Entry
105640404         CDS       T03922                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
jcu  Jatropha curcas
Pathway
jcu00010  Glycolysis / Gluconeogenesis
jcu00053  Ascorbate and aldarate metabolism
jcu00071  Fatty acid degradation
jcu00280  Valine, leucine and isoleucine degradation
jcu00310  Lysine degradation
jcu00330  Arginine and proline metabolism
jcu00340  Histidine metabolism
jcu00380  Tryptophan metabolism
jcu00410  beta-Alanine metabolism
jcu00561  Glycerolipid metabolism
jcu00620  Pyruvate metabolism
jcu00903  Limonene and pinene degradation
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105640404
   00053 Ascorbate and aldarate metabolism
    105640404
   00620 Pyruvate metabolism
    105640404
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105640404
   00561 Glycerolipid metabolism
    105640404
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105640404
   00310 Lysine degradation
    105640404
   00330 Arginine and proline metabolism
    105640404
   00340 Histidine metabolism
    105640404
   00380 Tryptophan metabolism
    105640404
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105640404
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    105640404
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105640404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105640404
NCBI-ProteinID: XP_012080093
UniProt: A0A067KFT8
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MAARRISSLISRSLSVSLSSSSSSLLLSLGRNPSRAQSICRFSTASVAEEPITPPVQIRY
TQNLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAEDIDRAVAAARKAFDEGPWPKMT
PYERSRILLRFADLVEKHNDELAALETWNNGKPYEQSAKSELPMLARLFRYYAGWADKIH
GLTVPGDSNHHIQVLHEPIGVAGQIIPWNFPLILFAWKVGPALACGNTIVLKTAEQTPLT
ALYAGKLFHDAGLPPGVLNVVSGYGPTAGSALASHMDVDKISFTGSTETGKVILELAAKS
NLKPVTLELGGKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVE
KAKARAVRRVVGDPFKKGVEQGPQIDDEQFQKVLRYIKSGIESNGKLECGGERLGSKGYF
IQPTVFSNVQEDMLIAKDEIFGPVQSILKFKDVDEVIRRANSSRYGLAAGVFTKNIDTAN
TLSRALRAGTVWVNCFDVFDAAIPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgcaggatatcttccttaatctcccgttctctctctgtttctctttcctct
tcttcttcttctcttctgctttctctaggaagaaatccaagcagggctcaaagcatatgc
aggtttagcactgcttcagtagctgaggaaccaatcactccacctgttcaaataagatac
acccagaatctaattaatgggaaatttgttgatgcagcatctgggaaaacgtttcctgca
tatgatcctcgtactggagaagtgattgctcatgtagctgaaggtgatgctgaagatata
gacagggcagtagcagctgctcgcaaagcgtttgatgaaggaccctggccaaaaatgacc
ccttatgaaaggtcacggattctgttgcgttttgctgatttagttgagaagcacaacgat
gagcttgcagctttagagacatggaataatgggaagccttatgaacagtctgctaaatct
gagttacccatgttagcgcgtttatttcgttactatgctggttgggcggataagattcat
gggctaacagttcctggagacagtaatcaccatattcaagtattgcatgaacctattgga
gttgcagggcaaattattccatggaattttcctcttatcttgtttgcttggaaagttggt
cctgcattagcttgtggtaatactattgtactgaaaacagcagaacagacacctcttact
gctctctatgcaggaaagctcttccatgatgctggccttcctccaggtgttctgaatgta
gtttcaggctatggtccaactgctggttcagctcttgccagtcacatggatgtagacaag
atttctttcacaggatcaactgagacaggcaaggttatcctcgaattggctgctaaaagt
aatcttaagccagttacattagaacttggagggaaatcacctttcatagtatgcgaagat
gctgatattgacaaggctgtggagcttgcacactttgccttgttctttaatcagggccaa
tgttgttgtgctgggtctcgtacgtatgtacacgagcgcgtgtatgatgagtttgtagag
aaagcaaaggcacgtgctgtgagacgtgttgttggtgatccctttaagaagggtgttgaa
caaggccctcagatcgatgatgagcaatttcagaaggtcctgaggtatataaaatctggc
attgaaagcaatggtaaactcgaatgtggaggtgaaaggcttggctccaagggctacttt
atccagcccactgttttctcgaatgttcaggaagatatgttgatagcaaaagatgagatc
tttggtccagtgcaatcaatcttgaagttcaaggatgttgatgaagtaataagaagggca
aatagttcccgctatggattggctgcaggagttttcacaaagaacattgatactgccaat
accttgtcaagagcattgagggcaggaacagtgtgggttaactgctttgatgtcttcgat
gcagcaattccttttggtggttataagatgagtggttttggcagggaaaaaggtatctac
agccttaataactacttgcaagttaaagctgttgttactcctttaaagaatccggcttgg
ttgtaa

DBGET integrated database retrieval system