KEGG   Jatropha curcas: 105640931Help
Entry
105640931         CDS       T03922                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
jcu  Jatropha curcas
Pathway
jcu00310  Lysine degradation
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105640931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:jcu03036]
    105640931
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     105640931
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     105640931
Chromosome and associated proteins [BR:jcu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105640931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 105640931
NCBI-ProteinID: XP_012080731
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MMEKLQMEMEMEMEAGEDIGIGEDITLPLFPLSFSLHDSFLHSHCSACFSPLPNPHSSTS
CPPFLYCSPICSSLHFSCAEFYLLQSLSSVSAPPSSTSDLRVALRLLHSLPSLSAKDGRI
SGLLTNREKLMTDNEIFTRIRDGAKAIAATRRLRDGKVAVTAANENDEVSLEESALCLVL
TNAVEVQDNEGRTLGIAVYDHTFSWINHSCSPNACYRFLISPLSIAPFPSESRQAIVPAG
SNGEKSAFSNIELTKGHGEYGPMIVVRSIKRIKKGEKVTVAYTDLLQPKAIRQSELWSKY
RFSCCCTRCNASLPSYVDRMLQETTAANLASSSSSSYHSFHRDVANRNLIDYVDEVITEY
LSSGDPESCCEKLESVLVLGLLDEPLETKEGKSQLTVKLHPLHHLALNAYMTLASAYRIR
ASEYLAVSSDTNGHQLEVFGMLRTGAAYSFLLAAASHHLFCFESSLIASVANFWTSAGES
LLTLARSSLWDLFGKWELPESKHFSLAKYKCSNCSLLDRFEANFSHCHAVNNDFENISSK
FLDCITSFSREVWSFLIQDCNYLKLLNDPFNLNSLGKLSNISDFVADSGYEAKKYANEER
VTIFRLGFHCLLCGELLASICYGRNSHRTRYIQSLLCYDYQEK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaagttgcagatggaaatggagatggagatggaagcaggtgaggacatagga
ataggagaagacattactctacctctatttcctctctctttctctcttcacgactccttc
cttcactctcactgctctgcttgcttctctcctctccctaatccacactcttctacttct
tgtcctccttttctctattgttctcctatttgctcctctcttcacttctcttgcgccgaa
ttctaccttctgcaatctctctcctctgtctctgctccaccctcctccacctccgacctc
cgcgttgccctccgcctcctccattctctcccctccctctccgccaaagacgggaggatt
tccggattattgaccaatcgcgagaaattgatgacagataacgagatattcacgcgaatt
cgagacggagcaaaggcgattgcggctaccaggagactgagagatggaaaggtagccgtc
actgcggcgaatgaaaatgatgaggtgtcgttggaggagtcggcgctgtgtttggtgcta
acgaacgccgtagaggtgcaagacaatgaagggcgcactctcgggattgctgtttatgat
catactttctcgtggattaatcacagctgttctcctaatgcttgttatcggttcttaatt
tctccactgagtatagcgccatttccgtcggaatccaggcaggcaattgttcctgccggc
agcaatggggagaagagtgcttttagcaatattgaacttacaaaaggacatggtgaatat
gggccaatgatagttgtgaggagcattaagaggatcaagaaaggagagaaggtaactgtg
gcatatacagacttgttgcaacctaaggcaataagacagtcagagttgtggtcaaaatat
cgttttagctgttgttgtacaaggtgtaatgcctcgcttccatcttatgtagatcgtatg
ttgcaggaaactactgctgcaaatctggcatcgtctagctcaagttcttatcacagcttt
catagagatgtagcaaacagaaatctgattgattatgtagatgaagttataaccgagtat
ctctccagtggtgatcctgaatcttgctgtgagaagcttgagagcgtgcttgttcttgga
ctcttagacgagccactggagaccaaggaaggaaaatcacagttgactgtcaagctgcat
cccctgcaccatcttgctctaaatgcatatatgacgttggcttctgcatatagaatccgt
gcaagtgaatatcttgctgtttcttctgataccaatggacatcagttggaagtctttggc
atgttgaggactggtgcagcatactcctttttgcttgcagccgcatctcaccaccttttc
tgctttgaatcttcactgattgcctctgttgcaaatttctggacaagcgcaggtgaatcc
ttattaactcttgctagaagctcattatgggatttgtttggtaaatgggagttgcccgaa
tcaaaacatttttcactcgctaaatataaatgctcaaattgctcattgctggatagattt
gaagcaaatttctctcattgtcatgctgtaaataacgattttgagaacatatcaagcaaa
tttcttgattgtatcactagtttttcacgggaagtttggagttttctaattcaggattgc
aattatttgaaattgcttaatgatcccttcaatctgaattcgcttgggaaattgtcgaat
atatcggactttgtggctgattctggatatgaagcaaagaagtacgccaatgaggaacgg
gtaactatttttcgtcttggattccattgcttactctgcggtgaacttttagcaagtata
tgttatggtagaaattctcaccgaactagatacattcagagtcttctatgttatgattac
caagagaaatga

DBGET integrated database retrieval system