KEGG   Jatropha curcas: 105641100Help
Entry
105641100         CDS       T03922                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
jcu  Jatropha curcas
Pathway
jcu00564  Glycerophospholipid metabolism
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105641100
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105641100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 HI0933_like GIDA Pyr_redox_3 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 105641100
NCBI-ProteinID: XP_012080960
UniProt: A0A067K2M6
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MSSATRFRRLGVAAIITATAATTGGFLSPTFATNDHGVRPALDPVKQKITDPNAVVPSRA
AQESVLIGATTANPLDVLVIGGGATGTGVALDAVTRGLRVGLVERDDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLRLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGPRLLHLSRYYSAQESLELFPTLAKKGKDKTLKGTVVYYDGQMNDSRLNVA
LACTAALAGAAVVNHAEVISFLKDEADERIIGARIRDNLSGKEFETYAKVVVNAAGPFCD
SVRKMAKNDAQPMICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSNTIITPLPEPHEDEIQFILDAISDYLSVKVRRIDVLSAWSGIRPLAIDPSAKSTESIS
RDHVVCEDHPGLVTITGGKWTTYRSMAEDAVDAAVKSGKLSPTNECSTQNLRLIGGDGWE
PSSFTVLAQQYVRMKRSYGGKVVPGVMDTAAAKHLSHAYGTMAERVAAIAQNEGLGKRLA
HGYPFLEAEVAYCARNEYCETAVDFIARRSRLAFLDTDAAGRALPRIIQILATECNWDKA
RQKQELENAKKFLETFKSSRNAQFHDGKH
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaccaggtttcgccgcctcggcgttgcagctattataaccgccactgcc
gccacgactggtggcttcttatccccaacatttgccaccaacgaccatggcgttaggcct
gctctcgaccctgtgaaacagaaaattactgatccgaatgccgttgttccatctcgagcg
gctcaggaatcggttttgattggtgcaactactgctaatcccctcgatgttcttgtgatc
ggcggtggcgccactggcactggagtggcgctcgatgctgtgaccagaggacttcgcgtt
ggtctggtcgagagagatgatttctcttctggtacctcttcaaggtctacaaagctaatt
cacggaggagttcgctacttggagaaggcagtcttcaatcttgattatgggcaactgagg
ctggtttttcatgcacttgaggaacgcaaacaggttattgacaatgcacctcacctgtgt
catgctttgccttgcatgacaccctgttttgactggtttgaggtagtatactattggatg
ggtttgaaaatgtacgatttggtcgcaggaccacgcttgttacatttgtccagatattat
tctgcacaggagtcccttgaacttttccccactcttgctaaaaagggtaaagataaaacc
ttgaagggcacagtggtgtattatgatgggcagatgaatgactcacggcttaatgttgct
ttggcatgtactgctgcattagctggtgcagcagtggttaaccatgcagaagtgatatct
tttttaaaggatgaggcagatgagcggataattggtgcacgtatccgggacaatctgtca
ggcaaagagtttgagacctatgcaaaagtagttgtgaatgcagctgggccattttgtgac
tctgtaaggaaaatggctaagaatgatgcacaacctatgatctgtccaagtagtggtgta
catattattctccctgattattattctccagaaggaatgggtttgattgttcccaaaaca
aaggacggacgtgttgttttcatgttgccatggttggggagaacagttgctggaactaca
gattctaacactatcatcactccactccctgagccacatgaggatgagattcagtttata
cttgatgctatctcagattaccttagtgttaaggtacgcaggatagatgttctttcagcc
tggagtggcattcgcccattggctatagatccatcagcaaagagcacagaaagtatctcc
agagatcatgttgtatgtgaagatcatcctggtttggtcacaatcactggtggaaaatgg
accacttaccgaagcatggcagaagatgcagttgatgcagctgtaaagtcgggaaagcta
agtccaacaaatgaatgctcaactcaaaacctgaggctgattggtggtgatggatgggag
ccttcatcgttcacagtccttgctcaacaatatgtacgtatgaagaggtcatatggtggt
aaagttgttcctggagtgatggacactgctgctgctaagcacttgtcacatgcatatggt
acaatggcagaacgagtagctgccatagctcagaatgaaggtctagggaagcgacttgcc
catgggtacccttttctagaggcagaggttgcctactgtgcccgaaatgagtactgtgaa
actgcagttgatttcattgctaggagatcacgacttgctttcctggatactgatgcggca
ggccgggcattgccacgcatcattcagatactggctaccgagtgcaattgggataaggca
agacaaaagcaagagttggaaaatgctaaaaaatttttagaaacattcaagtcttcaaga
aatgctcaatttcacgatggaaaacactaa

DBGET integrated database retrieval system