KEGG   Jatropha curcas: 105641357Help
Entry
105641357         CDS       T03922                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
jcu  Jatropha curcas
Pathway
jcu00020  Citrate cycle (TCA cycle)
jcu00190  Oxidative phosphorylation
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105641357
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105641357
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105641357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 105641357
NCBI-ProteinID: XP_012081269
UniProt: A0A067K1Y8
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MWRCVARAVRVPSCSSSSFSASNKSISNDSLRSHIPRFFSTQSTAGQYTIVDHTYDAVVV
GAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTV
KGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAY
RCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNNDGSCQGVIALNMEDGTLHR
FRAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCL
ITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYL
HLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKG
NDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEINRPGEKQKPLE
KDAGERTIAWLDKIRNANGSIPTSEIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWDS
FHDVKLTDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKW
MKHTLGYWENEKVRLNYRPVHMNTLDDEVETFPPKARVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgtgtggctcgcgccgttcgagttccttcttgttcttcttcttctttttca
gcttcaaataaatcgatctctaatgactctcttagatctcacattcccagatttttctct
actcaatccactgcagggcaatatacaattgttgatcatacatacgatgcagttgttgta
ggagcaggcggtgcagggttaagagctgctattggactctcagagcatggattcaacact
gcttgcattaccaaactttttccaacccgctcacacactgtggcagctcagggaggtatc
aatgctgcattgggaaatatgactgaagatgattggaggtggcatatgtatgacactgtc
aagggaagtgactggttaggtgatcaggatgccattcagtacatgtgtagggaggcacca
aaggcagttattgaactcgagaactatggattaccattttctcgaacagaagatggacga
atttatcagcgtgcatttggtggtcaaagtctagattttggaaaaggtggacaggcatat
cgttgtgcgtgtgctgctgaccgaaccgggcatgctcttttgcatactctctatgggcaa
gctatgaaacataatacacaattttttgtggaatattttgctttggatctaataatgaac
aatgatggtagctgccaaggagtgatcgcattaaatatggaggatggaacattacatcga
ttccgtgctgcttcaactatcctggccactgggggctatggtagagcgtacttttctgca
acctcagctcatacatgtactggagatggcaatgctatggttgcaagggctgggcttcca
ctacaggatcttgagtttgttcaatttcatcctacaggcatttatggggctggctgccta
attacagaaggatctcgtggtgaaggtggtattcttaggaatagtgaaggtgaacgattc
atggaaagatacgctcctacagccaaggatcttgcttcaagagatgttgtttcaagatct
atgaccatggaaattcgggagggtcgtggagtaggacctttgaaggatcatatctatttg
cacttaaatcacttgcccccagatgtgctaaaagagaggcttcccggtatctctgaaact
gctgctatttttgctggtgtggatgttacaaaggaacccattcctgttttacctactgtg
cattataatatgggaggaattcccacaaattaccatggagaggtagttactgttaaaggc
aatgatcctgatgctgttgttcctggactgatggctgctggagaggcagcctgtgcatca
gttcatggtgccaatcgtcttggtgcaaattctctgcttgacattgttgtttttgggcga
gcttgtgcaaacagagtggcagagatcaatagaccaggggagaaacagaagcctctggaa
aaggatgctggagagaggacaattgcatggcttgacaaaataaggaatgcaaacggatcg
attccaacttcagaaatcaggttaaatatgcagagggtaatgcaaaataatgctgctgtg
ttccgtacgcaagaaacattggaagaaggttgtcagctgattgacaaagcatgggatagc
ttccatgatgttaaactgacggatcgtagtttaatatggaactctgacttaatagagacc
attgaattggaaaaccttttgataaatgcctgtattacgatgcattctgctgaggcccgg
aaagagagcagaggagcacatgcccgtgaagattttactaaaagagatgatgagaagtgg
atgaagcatactttgggatattgggagaacgagaaggtccgactcaattacagaccagta
cacatgaacacattagatgatgaggttgagactttcccacctaaagctcgtgtttattga

DBGET integrated database retrieval system