KEGG   Jatropha curcas: 105641862Help
Entry
105641862         CDS       T03922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
jcu  Jatropha curcas
Pathway
jcu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105641862
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105641862
Chromosome and associated proteins [BR:jcu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105641862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 105641862
NCBI-ProteinID: XP_012081879
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MLLEAMPATKKNFDSDQNHIDVAFNKLLKQIGNPVEFELPEWFNKWKPTPYTTIKRNIYL
TKKIKRRLEDDGIFCSCSPSPGSSGVCGRDCHCGMLLSSCSIGCKCGSSCLNKPFQHRPV
KKMKLVQTEKCGAGIVADEDIKRGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEI
NRDMVIDATYKGNKSRYINHSCSPNTEMQKWIIDGETRIGIFATRDIKKGEHLTYDYQFV
QFGADQDCHCGAVGCRRKLGVKPSKPKMSSDAALKLVACQVAVSSPKLKAILSGNDVYQN
GAFHVESSNHVHSNQQAGSRNCIGEVIKIFRPYSERSFGMIKRFDKHSRKHAIMFEDGVV
ELLDMSKEDWEFVTL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaggccatgcctgcaaccaaaaagaattttgatagtgatcagaatcacatt
gatgttgcattcaacaagctgctgaagcagataggcaatccggttgagtttgagcttcca
gaatggtttaataaatggaagcctacaccctacaccactataaaacgcaatatatatctt
accaagaaaattaaaaggcgtctagaggatgatggcatattctgttcctgcagtccatca
ccaggttcttctggtgtttgtggtagagattgccattgtgggatgctactgtctagctgt
tccataggatgcaaatgtgggagttcatgccttaacaaaccattccagcaccgacctgtg
aagaagatgaaattagtacagactgagaaatgtggagctgggattgtggcagatgaagat
attaaaaggggagagtttgtaatagagtatgttggagaagttatagatgataagacctgt
gaagaaaggctctggaatatgaaacaccgtggtgaaacaaatttttacttgtgtgaaata
aatcgagatatggtaattgatgccacatacaagggaaacaagtcaagatacataaaccac
agctgctctcctaatactgagatgcagaaatggataattgatggtgagacgagaatcggt
atatttgcaactcgtgacataaaaaagggcgagcatctgacctatgattatcagtttgtt
caatttggtgcagatcaagactgtcattgtggtgctgttggctgcagaagaaagctcggg
gttaaacctagcaagcctaagatgtcttcagatgctgcattaaaattagtagcatgccag
gtggcggtgtcctctcctaaattgaaagcaattttatctgggaatgatgtttatcagaat
ggagcttttcatgtagagagttccaaccatgtccatagcaatcaacaggcaggctctcgt
aattgcattggcgaagtgattaaaatatttcgcccatatagtgagagatcttttgggatg
attaaacgatttgataagcattcaagaaaacatgcgataatgtttgaagacggtgttgtc
gaacttctggacatgtcaaaagaagattgggaatttgtgactttgtga

DBGET integrated database retrieval system