KEGG   Jatropha curcas: 105642014Help
Entry
105642014         CDS       T03922                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
jcu  Jatropha curcas
Pathway
jcu00010  Glycolysis / Gluconeogenesis
jcu00020  Citrate cycle (TCA cycle)
jcu00620  Pyruvate metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
Module
jcu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105642014
   00020 Citrate cycle (TCA cycle)
    105642014
   00620 Pyruvate metabolism
    105642014
Enzymes [BR:jcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     105642014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 105642014
NCBI-ProteinID: XP_012082077
UniProt: A0A067KC33
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MASSSSAFLSKISISNKSISFSSSVSPSFPSFPSTFPSKSHRCNRRNNALRVQSKIREIF
MPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGES
APVGAPIGILAETEDEIAEAKAKAATKTGGAAPAAAAPPTPTPPTASTPTPTPASAPVAD
VAEGPRKTVATPFAKKLAKQHKVDINKVVGTGPHGRITPADVEAAAGITPKPVAAEPVPV
LAAAPAAPAKAAASPTAPLLPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVTTDALD
ALYEKVKPKGVTMTALLAKAAAVALVQHPVVNSCCKDGKSFTYNSNINIAVAVAINGGLI
TPVLQDANKLDLYLLSQKWKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPP
GQGAIMAVGASKPTVVADADGFFSVKSKMLVNVTADHRIIYGADLAAFLQTFAKIIENPE
SLTL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttcttctgctttcctttccaaaatctcaatctccaacaaaagcatctct
ttctcttcttctgtatctccttctttcccttcttttccttccacatttccttccaaatct
caccgctgtaatagacgaaataatgccttgcgagtccaatcgaagatccgtgagatcttc
atgcctgcactcagttccaccatgactgagggcaaaattgtttcctggattaaatccgaa
ggtgatgttctctctaaaggcgaaagcgtcgtagttgtcgagtccgataaggctgacatg
gatgttgagactttctacgatggaattctcgctgcaattgttgttcctgagggtgaatca
gctcctgttggtgctcctattggaattttagctgaaactgaagacgaaattgccgaagct
aaagcaaaagctgccaccaaaactggcggcgcggctcctgctgctgctgctcctcccact
cccactcctcctactgcttctactcctacccctactcctgcttcagctccagtagcagat
gtggcggaggggcccaggaagacagtggcgacaccttttgcaaagaagttggctaagcag
cataaggtggatattaacaaggttgtcgggacggggccgcacgggaggattacgcctgct
gacgtggaggcagcggctggtattactccaaagcctgtcgctgctgagcctgttccagtt
ttggctgcggctcctgctgctccggctaaagctgctgccagtcctacggctcctctgctt
ccggggtctaccgttgtaccgtttacaacaatgcaagctgcagtgtcaaaaaatatggtg
gagagtctttcagtccccacttttcgggttgggtaccctgtaacaactgatgctcttgat
gcactatatgagaaggtgaaaccaaagggtgtgactatgactgcattgttggcaaaagct
gcagcagtggcattggttcaacacccagttgtgaattcctgctgtaaagatggaaaaagt
tttacgtataacagtaatattaacattgctgtagcagtggcaatcaatggtggattgatt
actcctgttcttcaagatgcaaacaagttggatctgtatctattatcacaaaagtggaaa
gagttggtggagaaagccagagcaaagcaacttcagcctcatgaatacaactcagggaca
ttcactctttccaatttgggaatgtttggagtggataggtttgatgctattcttcctcct
ggccagggggctataatggctgttggagcatcaaaaccaactgtggtggctgatgctgat
ggattttttagtgtgaaaagtaaaatgctggtgaatgtaacagctgatcaccgaattatc
tatggtgctgacttggctgccttccttcagacctttgcaaagatcattgagaatccagaa
agcctgacattatag

DBGET integrated database retrieval system