KEGG   Jatropha curcas: 105643965Help
Entry
105643965         CDS       T03922                                 

Definition
(RefSeq) biotin carboxylase 1, chloroplastic
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
jcu  Jatropha curcas
Pathway
jcu00061  Fatty acid biosynthesis
jcu00620  Pyruvate metabolism
jcu00640  Propanoate metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
jcu01212  Fatty acid metabolism
Module
jcu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    105643965
   00640 Propanoate metabolism
    105643965
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105643965
Enzymes [BR:jcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     105643965
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     105643965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_3 ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 105643965
NCBI-ProteinID: NP_001292959
UniProt: C5ILA9
LinkDB All DBs
AA seq 536 aa AA seqDB search
MEATLPICKPKSAVISTTPGLLTGRSSGIGSSQCSFMVGSKVNFPRQRIRAGRVSHKAGK
SSNGGAIGVKCRADKILIANRGEIAVRIIRTAHELGIPCVAVYSTIDKDALHVKLADESV
CIGEAPSSQSYLLIPNVLSAAISRGCTMFHPGYGFLAENAVFVEMCREHGINFIGPNPDS
IRVMGDKSTARETMKNAGVPTVPGSDGLLQNTEEAVKLAHEIGFPVMIKATAGGGGRGMR
LAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADKYGNVVHFGERDC
SIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEM
NTRIQVEHPVTEMISSVDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFR
PGPGRITAYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDD
TIITGVPTTIDYHKLILEIEDFKNGKVDTAFIPKHEQELAAPQKIVPVKELASTTA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggaagccacattgcctatctgcaaacccaaatctgctgttatttcaacaactccaggt
ttattgactgggagaagtagcggaattgggagttctcaatgtagttttatggtgggaagt
aaagttaactttcccagacaaagaattagggctgggcgagttagccataaagcaggtaag
agcagcaatggaggtgctattggggttaaatgtcgtgctgataagattttgattgcaaat
agaggagaaattgctgttcgtattattagaactgctcatgaattggggattccatgtgtt
gctgtttactcaactattgataaggatgctcttcatgttaaattggctgatgaatctgtt
tgcattggtgaagcaccaagcagtcagtcctacttgttgattccaaatgttctgtcggct
gctatcagtcgtggatgtacaatgtttcatcctggctatggcttccttgctgagaatgcg
gtttttgttgaaatgtgtagagaacatggaatcaactttattgggcctaatcctgacagt
atccgagtcatgggtgacaaatcaactgccagagaaacaatgaagaatgccggtgttcca
actgtaccaggaagtgatgggttgctacagaatacagaggaagcagtcaagctggcccat
gaaattggttttcctgtgatgatcaaggcaacagcaggtggtggaggacgtggaatgcgt
ctagctaaagagcctgatgagtttgtgaagttgctccagcaagctaagagtgaggctgct
gcagcatttggaaatgacggagtttatttggagaagtacattcaaaatccaaggcatatc
gagttccaggttcttgcagataaatatggtaatgttgtccattttggtgagcgtgactgc
agtatccagagacgtaatcaaaagctgctggaagaggcaccctctcctgcattgacccct
gaattacggaaagctatgggcgatgcagcagttgctgcagcagcatccatagggtatatt
ggtgttggaacggttgagttccttttggacgaaaggggttccttctacttcatggaaatg
aacactagaatccaggttgaacatcctgttactgaaatgatttcctcagttgatttgatt
gaggaacaaattcgtgtagccatgggagaaaagcttcgctacaaacaggaagatattgtg
cttagaggacattcaattgaatgccgtatcaatgcagaagatgcttttaagggattccga
cctggaccaggaagaataacagcatacttgccatctggaggcccatttgttagaatggat
agccatgtttatcctgattatgtggttcctccaagttatgattctttactgggaaagctt
attgtgtgggctccaacccgagaaaaggcaattgaacgcatgaaaagagcactagacgac
actattattacaggagttcctacaacaatagactaccataaacttattcttgagattgag
gatttcaaaaatggcaaggttgacactgctttcattccaaagcatgagcaggagttagca
gcgccacagaagattgtaccagtcaaagaattggcaagtacaacggcatag

DBGET integrated database retrieval system