KEGG   Jatropha curcas: 105644652Help
Entry
105644652         CDS       T03922                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
jcu  Jatropha curcas
Pathway
jcu00220  Arginine biosynthesis
jcu00250  Alanine, aspartate and glutamate metabolism
jcu00260  Glycine, serine and threonine metabolism
jcu00630  Glyoxylate and dicarboxylate metabolism
jcu00710  Carbon fixation in photosynthetic organisms
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
jcu01210  2-Oxocarboxylic acid metabolism
jcu01230  Biosynthesis of amino acids
Module
jcu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
jcu_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105644652
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105644652
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105644652
   00260 Glycine, serine and threonine metabolism
    105644652
   00220 Arginine biosynthesis
    105644652
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jcu01007]
    105644652
Enzymes [BR:jcu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     105644652
    2.6.1.4  glycine transaminase
     105644652
    2.6.1.44  alanine---glyoxylate transaminase
     105644652
Amino acid related enzymes [BR:jcu01007]
 Aminotransferase (transaminase)
  Class I
   105644652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105644652
NCBI-ProteinID: XP_012085470
UniProt: A0A067JRR4
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MAPKPLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLMFPADAIARAKYYLSLTSGGLGAYSDSRGMPGIRKEVAEFI
ERRDGYPSDPEHIFLTDGASKGVMQLLNTIIRGEGDGILVPVPQYPLYSAAISLFGGSLV
PYYLEETANWGLDINDLRHAVAEARAKGITVRAMVIINPGNPTGQCLSEANLREILRFCY
QENLALLGDEVYQQNIYQDERPFISARKVLLDMGPPISKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYDQFVREGKGIL
ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRLGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKFNDEFMEQYEDHTGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaaaccgttagactatgaatctttgaatgaaaatgtgaagaaggttcaatat
gctgtcagaggagagctgtatcttcgagcttctgagcttcaaaaggaaggaaagaggatt
attttcacaaatgtgggcaacccccatgctttaggacaaaagccgcttacttttcctcgt
caggttgttgctctgtgccaagctccatttctactagatgatcctaatgtaggactgatg
ttccctgcagatgcaattgcaagagctaaatattatctttcactgacttctggtggtcta
ggtgcttacagtgactcccgaggtatgccaggaataagaaaggaggtggcagagttcatt
gaaaggcgtgatggatatccaagtgatccagaacatatatttctcaccgatggtgctagc
aaaggagtaatgcagctcttgaatacaataatccgtggtgaaggtgatgggattttggtt
ccagtcccacaatacccactttactctgctgccatatctctgtttggtggttccctcgta
ccatattacctggaagagacagcaaattggggtcttgacattaatgacctgcggcatgca
gttgctgaagctcgtgctaaaggaataactgtaagagcaatggtgattattaacccaggt
aaccccactggtcagtgtcttagtgaagctaatttgagggaaattttgcgcttttgttac
caagagaacttggcccttcttggagatgaagtttatcagcagaacatataccaggatgag
cgcccctttattagtgctagaaaggttttgctggatatggggccacccataagcaaggaa
gttcagcttgtttctttccacacagtgtccaaaggatattggggtgaatgcgggcagcgg
ggtggatactttgaaatgaccaacattccacctaagacagttgatgagatttataaggtg
gcatctgtgtcactcagtccaaatgtgcctgctcagatatttatgggtctgatggtcaat
ccacccaaacctggagatatttcatatgaccagtttgttagggaaggcaaaggaatcctt
gaatcgctgaggagaagagcaaggctaatgaccgacggattcaacagctgcagaaatgta
gtttgcaatttcacagaaggtgctatgtattcatttcctcaaatacggttgccacctaaa
gcaatagaggctgctaaaaggcttggaaaagttcctgatgttttctactgtcttaagctt
ttggaagctactggcatttccaccgttcctggttccggatttggacaaaaagaaggggtc
tttcatttaagaacaaccattttaccggctgaggaagaaatgccggcaattatgtccagt
ttcaaaaagttcaatgatgagttcatggagcaatatgaagatcatacgggttattcaagg
atgtaa

DBGET integrated database retrieval system