KEGG   Jatropha curcas: 105648525Help
Entry
105648525         CDS       T03922                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
jcu  Jatropha curcas
Pathway
jcu00040  Pentose and glucuronate interconversions
jcu00051  Fructose and mannose metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105648525
   00051 Fructose and mannose metabolism
    105648525
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105648525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP ThiF Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 105648525
NCBI-ProteinID: XP_012090335
UniProt: A0A067JET3
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MGKGGMSLDEIKDGQEEENMAAWLLGVDNLKIQPFKLPPLGPYDVRVRMKAVGICGSDVH
YLKTLRLADFVVKEPMVIGHECAGIIDEVGSEVKHLVRGDRVALEPGISCWRCNLCKEGR
YNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANV
GPETNVLIMGAGPIGLVTLLAARAFGVPRIIVVDVDDYRLSVAKDLGADGIVKVSTNIQD
VAEEVALIHKAMETGVDITFDCAGFNKTMSTALGATKQGGKVCLVGMGHNEMTVPLTSAA
TREVDVIGVFRYKNTWPLCLEFLKSGKIDVKPLITHRFGFSQKEVEEAFETSARGGSAIK
VMFNL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggagggatgtcacttgacgaaatcaaggatgggcaagaagaggaaaacatg
gctgcgtggcttcttggtgtcgacaatctcaagattcagcctttcaagctccctcctctt
ggaccatatgatgttagagtaaggatgaaagctgttggtatctgtggaagtgatgttcac
tatctcaagaccttgagattggcagattttgtagtgaaggaaccaatggtcattgggcat
gagtgtgctgggatcatcgatgaggttggaagtgaagttaagcatcttgtgcgtggagac
agagtggcattggaaccaggcatcagttgctggagatgcaatctttgcaaagaaggtcga
tacaatctatgccctgagatgaagttttttgccactccaccagtacatggttctcttgcc
aatcaggtggtgcatcctgccgacctatgttttaaattgccagataatgtgagcttagag
gaaggcgcaatgtgtgagcctttaagtgttggtgttcatgcttgtcgccgagctaatgtt
ggtccagaaacaaatgttttaatcatgggagctggacccatagggcttgttacactgcta
gcagctcgtgcttttggtgtacccagaattatcgttgtggatgttgatgattaccgttta
tctgttgccaaggatctcggtgctgatggcatagttaaagtgtcaacgaatattcaggat
gtagctgaagaagttgcgctgatacacaaggcaatggaaactggagtggatatcaccttt
gattgtgcaggatttaacaaaacaatgtcaacagccttgggtgccactaaacagggtggc
aaagtttgccttgtgggaatgggccataatgaaatgactgttcctcttacatcagctgca
acaagggaggttgatgtcattggtgttttccggtataagaatacatggccactatgcctt
gaattcttgaagagtggtaagattgatgtgaagcccctaataacccacagattcgggttc
tcgcagaaggaggttgaagaagcctttgaaacaagtgctcgtggtggtagcgctattaag
gtcatgtttaatctgtaa

DBGET integrated database retrieval system