KEGG   Jatropha curcas: 105648651Help
Entry
105648651         CDS       T03922                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 4, chloroplastic isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
jcu  Jatropha curcas
Pathway
jcu00010  Glycolysis / Gluconeogenesis
jcu00030  Pentose phosphate pathway
jcu00051  Fructose and mannose metabolism
jcu00052  Galactose metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
jcu01230  Biosynthesis of amino acids
jcu03018  RNA degradation
Module
jcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105648651
   00030 Pentose phosphate pathway
    105648651
   00051 Fructose and mannose metabolism
    105648651
   00052 Galactose metabolism
    105648651
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105648651
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jcu01009]
    105648651
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:jcu03019]
    105648651
Enzymes [BR:jcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105648651
Protein phosphatases and associated proteins [BR:jcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105648651
Messenger RNA biogenesis [BR:jcu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105648651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 105648651
NCBI-ProteinID: XP_012090503
UniProt: A0A067JEY3
LinkDB All DBs
Position
Unknown
AA seq 530 aa AA seqDB search
MDLSIPSSFFETFSSHSLLHPLFPSNFQKLRSFPINSYFNLKSRKFPSKSLSWRQNCNYL
RSQISSGNVDDVFVLEDVPHLTDFLPDLASYSNPLKKSQAYAIVKQSFVTSEDVVAQKIV
VQRNSPRGVHFRRAGPREKVYFTPEEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVDN
VLGIEGGYRGFYSKNTLTLTPKVVNDIHKRGGTFLRTSRGGHDTHKIVDSIQDRGINQVY
IIGGDGTQKGAALIYKEVEKRGLRVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINA
AHVEVESVENGVGIVKLMGRYCGFIATHATLASRDVDCCLIPESPFYLEGPDGLFEYIEL
RLKENGHLVIVVAEGAGQDYVAQSTHAAYEKDASGNKLLLDVGLWLSQKIKDHFVNVRKM
EVNMKYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYTGFTVGPVNSRHAYIPISR
VTEATNTVKLTDRMWARLLASTNQPSFLNSNDMLQERSIDGETVTVTKTT
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtcaatcccttcatctttttttgaaaccttctcttcgcactctctccttcat
cctttgtttccttcgaacttccagaaactgagatcatttccgattaatagctacttcaat
ctcaaatccagaaagttcccctcaaaatccttgtcttggcgccaaaattgtaactatctc
agatctcagatttccagcggtaatgttgacgatgtctttgtccttgaagatgtccctcac
ttgactgatttcctccctgatttagcgtcgtattcaaatccattgaagaagagtcaagca
tatgccattgtcaagcaaagtttcgttacatcagaagatgtggttgcgcaaaagattgtt
gtacagagaaacagtcccagaggagtgcattttaggcgtgcagggcctcgcgagaaggtc
tattttacgcctgaggaagtgcgtgcttgtattgtgacttgtgggggtttgtgtccggga
atcaatacggtcatccgggagatagtctgtggattgaactatatgtatggtgtcgataat
gtgctcggcattgagggaggttatagaggtttctactccaaaaacaccttgacgttgact
cctaaagttgtaaatgacatacataaacgcggtggcacctttcttcgcacctctagagga
ggtcatgatacccacaagatagttgatagtattcaggataggggaataaatcaggtatat
attattggaggtgatggcacccagaaaggagcagcactaatctacaaggaagttgagaaa
cgtggtcttcgagtggcagttgctggtatccccaagacaattgataatgatatcgctgtg
atagacaaatcttttggatttgatactgctgttgaggaagctcagagagcaattaatgct
gctcatgtggaggttgaaagtgtggaaaatggagttggaatagttaaactgatgggcaga
tactgtggtttcatcgccacacatgctactttggcaagtagagatgtggattgttgcttg
attccagaatctccattctatctggaaggaccagatgggctgtttgaatatattgagcta
cggcttaaggaaaatgggcatttggtcattgtggtagcagaaggagctgggcaggactat
gtagctcagagcacacatgcagcatatgagaaagatgcatcaggaaacaagctacttctt
gacgttggtctttggttatctcagaaaattaaggatcattttgtgaacgttcggaagatg
gaagtgaacatgaaatatatagatcccacatacatgatacgcgccattccaagtaatgca
tcagacaacatttattgcactcttctagcacacagtgcagttcatggagccatggctggg
tacactggcttcacagtcggaccagtgaacagcagacatgcttatattcctatttcacgt
gtgactgaggcaacaaacacagtgaagttgacagataggatgtgggctagactacttgct
tctacaaatcagcctagtttcttgaattccaacgacatgttgcaagaaagatcaattgat
ggagagactgttacagttaccaagacaacatga

DBGET integrated database retrieval system