KEGG   Jeotgalibaca dankookensis: BW727_100549Help
Entry
BW727_100549      CDS       T04733                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
jda  Jeotgalibaca dankookensis
Brite
KEGG Orthology (KO) [BR:jda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jda01001]
    BW727_100549 (prkC)
Enzymes [BR:jda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BW727_100549 (prkC)
Protein kinases [BR:jda01001]
 Serine/threonine kinases: Other
  Bacterial family
   BW727_100549 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH RIO1 Pkinase_fungal Haspin_kinase Kdo DUF4366
Motif
Other DBs
NCBI-ProteinID: AQS52942
UniProt: A0A1S6IN18
LinkDB All DBs
Position
557978..560047
Genome map
AA seq 689 aa AA seqDB search
MLIAIGTKIGGRYKVLGLIGRGGMANVYLARDLILDRDVAVKILRFDFQSNKEALRRFKR
EALSTTQLIHPNIVSVYDVDEDDGLQYIVMEYIQGRDLKKFIQEKGQLSLEDVIHIMSQI
LSAMALAHQNRIIHRDIKPQNLLIDSDNVIKVTDFGIAIALSETSLTQTNSLLGSVHYMS
PEQARGSIPTIKSDIYALGIVLYELVTGKVPFDGESAVSIALKHFQEPIPSVRAERPEIP
QALENVILKATAKEPHDRYNSCEEMSQDLQTSLDDSRLQEAAFTPEVMLDETKVITPVKL
EGNDLPKTENTDQVTDVRKSQKKPRKKRIVWGILLILLLIVTGGSLAAMITNNNPDLIAV
PNVLGVKEEKAREMLLEANFTIGEVYTQYNENAEEGSVFKVDPEVNTQLAPKTAINLYIS
QGVEPFLIEDYSGQPYSDVRKELVKKGIQVEREDVYDSLDEGLIVGQSLESDTEVIPNET
TITLRVSLGPETFTMENLSGYTREDVERYAENYGLKLTIKTEKSEEVAEGLVLSQSIAAE
SSFYSGDSLEVIISEGMPQTSTETEKPKPEKPESQATESSSESKTEEPEIITFTKKITIP
YLPPEENSSETDSESDSPDVDNEEELKASNHIIIYMLDSDHQLTEVFREFDITEDKEVNL
NFRIYSDQPGAFIVERDGINIMEETNLID
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgcaattggtactaaaataggtggtcgatacaaagtattaggactaattgga
cgaggcggaatggctaatgtttatttagctagagatttgattttagatcgtgatgtagct
gtaaaaattttacgttttgacttccaaagcaacaaagaagctttaaggcgcttcaagcgc
gaggctctttcgacgacgcaactaatacacccaaatattgtatccgtttatgacgttgat
gaagatgatgggcttcaatatattgttatggaatacatccaaggtagagacttaaaaaaa
tttatccaagaaaagggtcaattatcacttgaagatgtgattcatattatgagtcaaatc
ctatctgcgatggctttggctcatcaaaatcggattattcatagagatattaaaccccaa
aacttgctgattgatagcgataatgttatcaaagtcacagattttggaattgctattgcg
ctttctgaaacatcgctaacgcagacaaactctttgttgggctcggttcactatatgtca
ccagagcaagcgcgtggaagtatcccaactattaaatctgacatctacgccttaggaatt
gttttatatgaattagtaaccggtaaagtaccctttgacggcgaatcagcggtttcaatt
gctttgaaacattttcaagaacctattccctctgtcagagcagaacggcctgagatccca
caagcattagagaatgttatcttgaaggcaacggctaaagagccacacgatcgctataat
tcttgcgaagaaatgtctcaagatttgcagactagtcttgacgatagtcgtttgcaggaa
gcagctttcacaccagaagtgatgcttgatgaaacaaaagtaatcacaccggttaaatta
gaaggaaacgacctaccaaaaacggaaaatacagatcaagtgacagacgtaaggaaatca
caaaaaaaaccacgtaagaaaagaatcgtatgggggattttattaattttattgctaatt
gttacgggtggtagtttagcagcaatgattactaataataacccagatttaatcgcagtt
ccaaatgtattaggggtcaaagaagaaaaagcacgtgagatgttattagaagcaaacttt
acaataggtgaagtatatacgcaatataacgaaaatgccgaagagggcagcgtgtttaaa
gttgatcccgaagtaaacacacaattagcacctaaaacagcaatcaatttatatataagc
caaggtgtagaaccatttttaatagaagactattctggacaaccctattctgatgtccgt
aaagagctggtaaaaaaaggtatacaggtagaacgcgaagatgtctatgattctcttgat
gaaggattaatagttggtcaaagtctagaatcagatacagaagtaatccctaatgagaca
acgattaccttacgagttagcctgggaccagagacatttactatggaaaatttaagtggt
tacacacgtgaagacgttgagcgttatgcggaaaactatggtctaaagctcaccatcaaa
actgaaaagtccgaagaagttgctgaagggttagtgctttctcaatctattgctgcagaa
agcagcttttacagtggggattctttggaagttattatttccgaaggaatgccgcaaact
tcaacagaaacagaaaaaccaaaacctgaaaaaccagaatcccaagcgacagaatctagc
tcagaatccaaaacagaagaaccagagattataactttcacaaaaaaaataacgattcct
taccttccgcctgaagaaaattcaagtgaaacggactcagaatcagatagtccagacgtt
gataatgaagaagaactcaaagcatccaaccatattattatctatatgttggatagtgac
catcagttaacggaagtttttcgagagtttgacataaccgaggataaagaagtgaattta
aatttccgtatttactctgatcaacctggtgcttttattgttgaacgggatggtataaat
ataatggaagaaaccaatctaattgattaa

DBGET integrated database retrieval system