KEGG   Jonesia denitrificans: Jden_0487Help
Entry
Jden_0487         CDS       T00972                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
jde  Jonesia denitrificans
Pathway
jde00564  Glycerophospholipid metabolism
jde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Jden_0487
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Jden_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACV08151
UniProt: C7R092
LinkDB All DBs
Position
complement(526833..528581)
Genome map
AA seq 582 aa AA seqDB search
MSALTASTAMTPETRIRSLEALKATTPEEPLDVLIIGGGVTGAGTALDAVTRGLDTAIIE
AQDWASGTSSRSSKLVHGGLRYLQMLDFSLVHEALTERDLLINKLAPHLVKPVPFLFPLI
KQYERPYIGAGIMLYDILASLAPGKRAMPFHRHHGRKSMERRFPSLRHDAAVGAIEYYDG
SVDDARLVLTLTRTAVSYGAHACSRTQVVELTKSPAGRVNGAVLKDLETGDTFTVHARHV
INSTGVWTEETEALAGGTGGLKVLASKGIHIVVPRDRIKGNAGLILQTEKSVLFVIPWSR
YWVIGTTDTPWEHDLQHPVATAEDIDYVLDHANAVLQDPLTRDDIIGTWAGLRPLLQPGT
KEGTSSAKVSREHTVASPNPGFTVIAGGKLTTYRVMAEDAVDFALGPEASARPSVTNNIP
LLGAVGLAAMTNQAKALSKRFGWSKQMIAHLLHRYGSMINEIAAACGQDPSLAEPLTHAD
AYLRAEIWYAAHNEGVIHLEDVMLHRTRIIYEYADKGRAAIDEITEIVGEALGWDEDRRA
QEKRSYLERIDAEEAAEQELDDAAAEKVRLRATEIAPMERLA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccctgacagccagcacggcaatgacgcccgaaaccagaattcgatccctggaa
gcattaaaggccaccacacctgaggagccgttagacgtcctcatcattggtggcggggtc
accggtgcagggacagcacttgacgcagtcacccgtgggctcgacactgcgatcatcgag
gcacaagactgggcatcggggacgtcaagccgctcttctaaacttgtccacggtggtttg
cggtacctgcaaatgctggacttctctcttgttcatgaagcactcactgaacgagacctg
ctcatcaacaagttggccccacacctggtcaaaccggtgcccttcttgttccccctcatc
aaacagtacgagcgcccctacattggcgcgggcatcatgctctatgacattcttgcctcg
cttgccccagggaaacgggcgatgccgttccaccggcaccacggccgcaaatccatggaa
cgccgctttccctcgctgcgtcacgacgctgctgttggagcgatcgagtactacgacggg
tccgtcgacgacgcacgtcttgtcctcaccctcacccgcactgccgtgtcctacggtgct
cacgcctgctcccggactcaagttgttgaactgaccaaatcaccggctggccgagtcaac
ggcgcagttcttaaagaccttgaaaccggcgacactttcaccgtgcatgcacggcatgtc
atcaactccaccggtgtgtggaccgaggaaacagaagcactggccggtggcaccggcggc
ctgaaggtccttgcgtccaagggcatccacattgtggtgccccgtgaccgaatcaagggc
aacgcgggcctgattttgcaaaccgaaaagtcagttctctttgtgatcccctggtcacgg
tactgggtgatcggaaccaccgacaccccgtgggagcacgaccttcaacacccggtcgcc
accgcagaagacatcgactacgtcctggatcatgccaacgcggtcctgcaagacccattg
acccgggacgacatcatcgggacctgggctgggttacggcctctgctgcaaccagggacc
aaagagggcacctcatcggcaaaggtttcgcgtgagcacacagttgcttccccaaaccca
ggattcaccgtgatcgcgggtgggaaactcaccacctaccgggtcatggcagaagacgcg
gtggactttgcccttggcccagaagcatccgcacgcccatcagtcaccaacaacatcccc
ctgcttggtgcagtggggttggcagccatgaccaatcaagccaaggcactgtccaagcgt
tttggctggtcgaagcagatgatcgcccacctgcttcaccgctacggctcgatgatcaac
gaaatcgctgcggcctgtggccaagacccttcgctggcagaacccctcacgcacgcagat
gcctacttgcgagccgaaatttggtatgcggcgcacaacgagggtgtcattcaccttgag
gatgtcatgctgcaccgaacccgcatcatctatgagtacgcggataaggggcgggccgca
atcgacgagatcaccgagatcgtcggcgaggcccttgggtgggacgaggaccgtcgcgcc
caagaaaagcggtcctacctggaacgcatcgacgctgaagaagccgctgaacaagaactc
gacgatgctgcggcagaaaaggtgcggttgcgcgccactgagatcgccccgatggagcga
ctcgcctaa

DBGET integrated database retrieval system