KEGG   Jonesia denitrificans: Jden_0685Help
Entry
Jden_0685         CDS       T00972                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
jde  Jonesia denitrificans
Pathway
jde00020  Citrate cycle (TCA cycle)
jde00480  Glutathione metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
jde01210  2-Oxocarboxylic acid metabolism
jde01230  Biosynthesis of amino acids
Module
jde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jde_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jden_0685
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Jden_0685
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Jden_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP NTP_transf_6
Motif
Other DBs
NCBI-ProteinID: ACV08349
UniProt: C7R1D4
LinkDB All DBs
Position
736589..737809
Genome map
AA seq 406 aa AA seqDB search
MGKIKVVNPVVELDGDEMTRIIWQFIKDRLIHPYLDIDLKYYDLSIQNRDATDDQVTVDA
ANAIKQYNVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKSTNFKVPGAGKITMTFEPADGSEPQQFDVVTMPEEGGVAM
GMYNFNESIKDFARASFAYGLQRNYPVYLSTKNTILKAYDGQFKDLFQEVFDAEYKEQFD
AAGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLMHRGKLDNTPEVVEFAQTLE
DVVVTTVESGKMTKDLALLISKDQEFLTTEEFLAAIDENLSARLAG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttgtaaacccggtcgtcgagcttgacggcgatgagatgacccgc
atcatctggcagttcatcaaggaccgcctcatccacccttacctcgatatcgacctcaag
tactacgacctgtcgatccaaaaccgtgacgccaccgacgatcaagtcaccgtagacgct
gcgaacgccatcaagcagtacaacgtcggtgtcaaatgcgccacgatcaccccggacgaa
gcccgcgtggaagaatttggactgaagaagatgtgggtatcgcccaacgggacgatccgc
aacattctcggtggcgtggtgttccgtgaacccatcatcatttcgaacattccccggttg
gtgcctgggtggaacaagcccatcatcatcggtcgtcacgcacacggtgatcagtacaag
tccaccaacttcaaggtgcctggagctggaaaaatcaccatgaccttcgaaccggcagac
ggcagcgagccgcagcagtttgacgtcgtcaccatgccagaagagggcggggtggccatg
gggatgtacaacttcaacgagtccatcaaggatttcgcgcgtgcatcgtttgcttacggc
ttgcagcgcaactaccccgtgtacctctcgacgaagaacacgatcctcaaggcctatgac
ggccagttcaaggacctgttccaagaagtgttcgatgccgagtacaaagaacagttcgat
gctgctggtctcacctatgaacaccgtcttattgacgacatggtcgcgtcggccatgaag
tgggaaggtggctacgtctgggcctgcaagaactacgatggtgacgtgcagtcggacact
gttgctcaagggttcggctcacttggcctgatgacgtcagtgttgatgaccccagacggg
aagaccgtggaggcagaagcagcccacggaacagtgacccgtcactaccgtcaacaccag
caaggcaaacccacctccacaaaccccattgcatccatttttgcgtggacccgtgggctg
atgcaccgtggaaagttggacaacacacctgaggtcgtggaatttgcgcagactcttgaa
gatgttgtcgtgacgaccgttgagtccggcaaaatgaccaaggatctggcgttgttgatc
tccaaggatcaggagttcctgactactgaggagttccttgcggcgattgatgagaacctg
tcagcacgtctcgctggctag

DBGET integrated database retrieval system