KEGG   Jonesia denitrificans: Jden_1221Help
Entry
Jden_1221         CDS       T00972                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00230  Purine metabolism
jde00620  Pyruvate metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
jde01230  Biosynthesis of amino acids
Module
jde_M00002  Glycolysis, core module involving three-carbon compounds
jde_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
jde_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1221
   00620 Pyruvate metabolism
    Jden_1221
  Nucleotide metabolism
   00230 Purine metabolism
    Jden_1221
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Jden_1221
Membrane trafficking [BR:jde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Jden_1221
Exosome [BR:jde04147]
 Exosomal proteins
  Proteins found in most exosomes
   Jden_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACV08877
UniProt: C7R420
LinkDB All DBs
Position
1304219..1305637
Genome map
AA seq 472 aa AA seqDB search
MRKAKIVCTIGPATSSPENMLRLVNAGMDVARINRSHGGYEEHEAVYRNIRAAAEEAGRN
VAVLVDLQGPKIRLGKFEEDRKYFLEVGDIFTITTDDILGNQEICSTTHKGLPQDARVGD
PILIDDGKVTVRVIEVEGNKVVTKCEVPGPLSNNKGLNLPGVAVSVPAMSDKDEDDLRWA
IRLGADIIALSFVRSARDYDDVRKVMEEEGRILPVVAKVEKPQAVDNLAEIVDAFDAIMV
ARGDLGVELPLEQVPLVQKRAVELARRAAKPVIVATQVLESMISSPRPTRAEASDCANAI
LDGADAVMLSGETSVGDFPIEAVETMAKIVEATEELGRERIAPLGSTPHTRGGAITRAAA
EIGETLGVKYIVTFTQSGDSARRFARLRSPLQHLAFTPRSDVRSVLALSWGVTSRQVDQV
ESTDAMVRQVDAKLQEDGLAESGDLVVVVSGAPVGVSGTTNSILVHRIGDDI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaagcaaagatcgtttgcaccatcggacccgcaacttcttccccggaaaacatg
cttcggcttgtgaacgccggcatggatgtggcacgtattaaccgtagccacggtgggtac
gaagaacacgaggctgtttaccggaacatccgggcagcagctgaagaggccgggcgtaac
gtcgcggttctcgttgacctgcaaggaccaaagattcgtctgggcaagttcgaggaagac
cgcaagtacttccttgaggtgggcgacattttcacgatcaccactgacgacatccttggc
aaccaggagatctgctccaccacccacaagggtcttcctcaggatgcacgtgttggtgac
cctatcctcatcgatgacggtaaagtcaccgtccgggtcattgaggttgagggcaacaaa
gttgtcaccaagtgtgaagttcctggcccgctgtccaacaacaagggtttgaaccttcct
ggtgtggctgtttctgtaccagccatgtcagacaaggacgaagatgaccttcgttgggcg
atccgcttgggtgctgacatcatcgctttgtcatttgtgcgcagtgcacgtgactacgat
gacgtgcgcaaggtcatggaagaagaaggacgtatccttcctgttgtggcgaaggttgaa
aagccacaggccgttgacaacctcgctgagattgttgatgcgtttgacgccatcatggtt
gcccgcggtgaccttggtgtggaacttcctttggaacaggttccactcgtccaaaagcgt
gctgttgagcttgcccgccgggcagcaaagcctgtcattgtggccacccaggtccttgag
tcaatgattagctcacctcgccccacccgtgcagaagcctctgactgtgcaaacgccatc
cttgatggtgctgacgctgtgatgctctcgggcgaaacatcagtgggtgacttccccatt
gaggccgttgagaccatggcgaagatcgtggaggccaccgaagaacttggccgtgaacga
atcgcgcccttggggtcaaccccacacacccgtggtggagctatcactcgggcggccgct
gaaatcggcgaaacccttggtgtgaagtacattgtgacctttactcagtcaggtgactcc
gcacgtcgtttcgcacgactgcgctcaccattgcagcaccttgcattcaccccacgttct
gacgtgcgttccgttcttgccctgtcatggggggtcacctcgcgccaggttgaccaggtg
gaatcaactgatgcgatggttcgtcaagtagacgcgaaactccaagaagacggtctcgct
gaatcaggcgatctcgtcgttgttgtctccggtgcccctgttggggtctctgggaccacg
aactcgattctcgtgcaccgcatcggtgacgacatctag

DBGET integrated database retrieval system