KEGG   Jonesia denitrificans: Jden_1680Help
Entry
Jden_1680         CDS       T00972                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
jde  Jonesia denitrificans
Pathway
jde00473  D-Alanine metabolism
jde00550  Peptidoglycan biosynthesis
jde01100  Metabolic pathways
jde01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Jden_1680
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Jden_1680
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Jden_1680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jde01011]
    Jden_1680
Enzymes [BR:jde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Jden_1680
Peptidoglycan biosynthesis and degradation proteins [BR:jde01011]
 Precursor biosynthesis
  Amino acid ligase
   Jden_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACV09327
UniProt: C7QYT8
LinkDB All DBs
Position
complement(1811396..1812565)
Genome map
AA seq 389 aa AA seqDB search
MENMSTSQTRPNNLGAPHAADRVRTRVLVLFGGRSGEHPISCITAAGVLRAIDRDRFDVV
AVGITQGGKWVLASTDPDEVVTSGDDLPHVADNGTEVLLPFASGDNEVRVIRDGVLESVG
PVDVVLPLLHGPFGEDGTVQGMLELADLRYVGVGVLGSAVGMDKHYMKLVFEGHGLPVGP
YTTVFPGQWQRDPDEVRARVVALGLPVFVKPTRAGSSLGISKVSDVGDLDRAMAEALKHD
PKVIIEAGIVGREIECAVLGGHGDTPARASLPGEITMTGSAHEFYDFEAKYLDDASAQLS
CPAELDETTTATVREVAVRAFDAVGGEGLSRVDVFVQEDGAVVVNEINTMPGFTPISMYP
RMWERSGVSYTELISELIDLALERPLGLR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatgtccacatctcagacgcgccccaataatctgggggctccccacgcggcg
gatcgtgtccgcactcgcgttcttgtcctgtttgggggccgctccggtgagcaccctatt
tcgtgtatcactgccgcgggtgtgttgcgtgctattgaccgtgaccggtttgatgtggtt
gcggtgggcatcacccaggggggaaagtgggtgttggcgtccactgatcctgatgaggtg
gtgacctcgggtgacgatctacctcacgtggcggacaacggtaccgaggtgttgttgccc
tttgcctcgggtgacaacgaggtgcgggtcatccgcgatggtgttcttgagtcggtagga
cctgttgatgtagtgctgccgttgctgcatggcccatttggtgaagatggcacagtgcag
ggcatgttggagctcgctgacctacggtatgtgggtgtgggggtgctgggctctgctgtg
gggatggacaagcactacatgaagcttgtttttgaaggacatggccttccagtagggccg
tataccactgtgtttcccgggcagtggcagcgtgacccggatgaggttcgtgcccgggtt
gtggcgttggggttgcctgtttttgtgaagccgactcgtgcgggctcatcattggggatt
tcgaaggtctccgatgtgggtgatcttgaccgggcgatggctgaggcgctcaagcatgac
ccgaaggtgattattgaggcgggcattgtcggccgtgagattgagtgtgctgttcttggc
gggcatggggacaccccggcccgagcatcgcttccaggtgagatcacgatgactggtagc
gcccatgagttttatgactttgaggcgaagtaccttgacgatgcgtcagcccagttgagt
tgcccagctgagttggatgagaccaccactgcgaccgtgcgtgaggtggcggttcgcgct
tttgacgcggtgggcggggaagggttgtctcgcgttgacgtgtttgttcaagaagatggt
gcagtggtggtcaatgagatcaacacgatgccggggttcacgccgatttccatgtatccg
cggatgtgggagcgatcgggtgtgtcgtacaccgagttgatttcggaactcattgatctt
gcgttggagcgtccgctgggtctgcgttag

DBGET integrated database retrieval system