KEGG   Jeotgalibaca sp. H21T32: EJN90_04560Help
Entry
EJN90_04560       CDS       T05782                                 

Definition
(GenBank) glycoside hydrolase family 3 protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
jeh  Jeotgalibaca sp. H21T32
Pathway
jeh00520  Amino sugar and nucleotide sugar metabolism
jeh01100  Metabolic pathways
jeh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:jeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EJN90_04560
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EJN90_04560
Enzymes [BR:jeh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EJN90_04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Phage_Capsid_P3
Motif
Other DBs
NCBI-ProteinID: AZP03999
UniProt: A0A3S9H9H0
LinkDB All DBs
Position
complement(987564..989291)
Genome map
AA seq 575 aa AA seqDB search
MVDLTKKPYYLKEEDIQWVQNTIENMTLEEKIGQLFVGMIRGMNQEQIMQQISDFTEKYQ
LGGIRYMNLPPEALYQQNELLQSKSKLPLLIAANAEAGGNGAVGQGTPIATGAAVASADS
EELAYQVGKIGSREAGAIGCNWNFSPIVDLTTNWRNTVVQTRAFNDNPDDVIRYSRSFLK
GTEEEGLITCIKHFPGDGTEENDQHLMMGVNNLSKEEWMDTFGKVYQTLIDDGVMTIMAG
HIALPSWQRELTDRPVADKDIKPATLSKEIISDLLKEQLNFNGLVVTDASHMVGLTASAP
RSELVPGAIAAGCDMFLFLDNPEDDLSYMMDGYKNGVITDERLEDALSRILGLKAAKQLH
KKQAEGTLMPPKEALSVVGCEEHKEIARKAAEEYITLVKDTQEMLPLSPEKHRRIQLVFV
EGDGMIVAGKAMGTDSEKTKKALISGLEKEGFEVEELIATDIMTAQKLSAREMREKFDAV
LVVLDVVSFVMFNSVRIKWPTPLQQPWYVKEIPTAFISLNLPNHLIDLTMSRTYINAHMD
HEEAVEVLIQKLIGKSEFKGRSNENVWCNRWDTKL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggttgatttaacgaaaaaaccatattatttaaaagaagaagacattcaatgggtgcag
aatactattgaaaacatgacactagaggaaaaaattgggcaattatttgttggaatgatt
cgcggcatgaatcaagaacaaattatgcaacaaatcagtgattttactgaaaagtatcaa
ttaggcggcattcgctatatgaacttgccaccagaagcactatatcaacaaaatgaactc
ttgcaatccaaatcaaaactaccattattaatcgctgcaaatgcagaggcaggcggaaat
ggtgcggtgggacaaggaacaccgattgcgacaggagcagcggttgctagtgcagactct
gaagaattggcataccaagttggaaagattggctcaagagaggctggtgcaatcggctgt
aactggaatttttctccaattgttgatttgacaacgaactggcgtaatacggttgttcaa
acacgggcattcaatgataatcctgatgatgttatccggtattcacgctccttcttaaaa
ggaacggaagaagagggactgataacttgtatcaagcatttccctggagatggtacagaa
gaaaacgaccaacatttaatgatgggagtaaacaacttaagtaaagaagaatggatggat
acgttcggaaaagtatatcagacacttatcgatgatggtgtcatgacgatcatggcaggg
catattgcactaccttcttggcaacgggaattaaccgataggccagtagccgacaaagac
attaagccagcaaccttgagcaaagaaatcatttctgatctattgaaagaacaactaaac
ttcaatggtttagtagtaacagatgcttctcacatggttggtttgacagcttctgctcca
agaagcgagttagtaccaggcgcgattgcggcaggctgtgatatgttcttgttcttggat
aatccagaggacgatcttagctacatgatggatggatacaaaaatggtgtaattacggat
gagcgtttagaagatgcattaagtcgcatacttggcttgaaagctgcaaaacagttgcat
aaaaaacaagcagaaggaacattgatgccgccaaaggaagccctgagcgtagtagggtgc
gaagagcataaagagattgctcgtaaagcagccgaagaatatattaccttagtaaaagac
acacaagaaatgctaccgctatctccagagaaacatcgtcgtattcaactagtttttgtt
gaaggggatgggatgattgtagccggaaaagcaatgggaacagattctgaaaaaacaaaa
aaagcgttgattagtggcctggaaaaagaaggctttgaagtagaagagttgattgctaca
gacataatgacagcccaaaaactaagtgcacgagaaatgcgtgagaagtttgatgcagta
ttagtagtactggatgttgtcagctttgtcatgttcaactctgtgcgtatcaaatggcca
acgccattacaacaaccatggtacgtgaaagaaataccgacagcgttcatcagcttaaat
cttccaaatcacttgatcgatttgacgatgagtcgtacctacatcaatgcacacatggat
catgaggaagcagttgaagtattaatacaaaaattaattggcaagagtgaattcaaagga
cgttcaaatgagaatgtttggtgtaatcgttgggatacgaaactatag

DBGET integrated database retrieval system