KEGG   Jeotgalibaca sp. H21T32: EJN90_05720Help
Entry
EJN90_05720       CDS       T05782                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
jeh  Jeotgalibaca sp. H21T32
Pathway
jeh00500  Starch and sucrose metabolism
jeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EJN90_05720
Enzymes [BR:jeh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EJN90_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AZP04204
LinkDB All DBs
Position
complement(1240871..1242379)
Genome map
AA seq 502 aa AA seqDB search
MLENGIIMQYFEWELSNDGQLWNQLKKDAAHLKELGVSAVWLPPAYKGTGQEDVGYGVYD
LYDLGEFDQKGTVRTKYGTKEEYLAAIEALHELDISVYADVVLNHKAGADETERFYAAEV
DPNNRQEKVSDFYEIEGWTKFTFPGRKNKYSDFKWDWEHFTGTDLNKENDKEAIYLIKGI
NKGWSEDGFVDDEFGNFDYLMYADIDYGNSEVVEEIKKWAQWYIDETGVDGFRLDAIKHI
DRRFIKDFVYAIRENDRPDFFVVGEYWKADYDTIQEYLEATEYAVDLFDVPLHFNFHTAS
VVGGEYDLRDLFNNSLIANAPVQAVTFVDNHDSQPGQALESFVASWFKPMAYAFILLRRE
GFPCLFYGDYYGINGENPVEPMTEMLDKLLYVRRNHAYGEQKDYFDDAHYVGWTRLGDEE
HPFGLAAIIANQDVDGVKEMYVGEQYAGETFADYMGNFDKRVTIDENGCGKFLVRGNSVS
VWVKDAVTPEEAFVEDAEESEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaacgggataattatgcaatattttgaatgggagctgtcgaatgatggtcag
ctatggaatcagttaaagaaagatgctgctcatttgaaagaattgggtgttagtgcagtt
tggttacctcctgcttataaaggaacgggtcaagaggatgttggctatggtgtgtatgat
ttatatgatttaggagaatttgatcaaaaaggtacagttcgtaccaagtacgggacgaag
gaagagtacttagcagcaattgaggctcttcatgaattggatatttcggtttatgcagat
gttgtgctgaatcataaagctggtgcagatgagacagagcggttttacgctgcagaagta
gacccgaataatcgacaagaaaaagtcagtgatttttatgaaatcgaaggatggacaaaa
ttcacttttcctggaagaaagaataaatattctgactttaaatgggattgggaacatttt
acgggaacagaccttaacaaagaaaatgacaaagaagccatctatctcattaaaggaatc
aacaaagggtggagcgaagatggctttgtggatgatgagtttggtaattttgattatttg
atgtatgcagatattgattatggaaactcagaagtagtcgaagaaataaaaaaatgggcg
caatggtatatcgatgaaacaggtgtagatggttttcgtctggatgccatcaaacatatt
gaccgccgattcataaaagatttcgtatacgctatacgcgaaaatgatcgacctgatttt
tttgttgtaggtgagtattggaaagcggattatgataccattcaagaatatttagaagcg
acggaatatgctgttgatttatttgatgtaccgctccactttaatttccataccgcttct
gtcgtgggcggggagtatgatttgcgagatttatttaacaactcgctgatcgcaaatgcg
cctgtacaggcagttacatttgtagataatcatgattcgcagcccgggcaggctttagag
tcctttgtggcctcttggtttaaaccgatggcgtatgctttcattttattgcgccgagaa
gggtttccttgtttgttttacggtgattactatggaattaatggagaaaatcccgttgaa
ccgatgacagaaatgcttgataaattattgtatgtaagaagaaaccatgcttatggggaa
caaaaggattactttgacgatgctcactacgttggctggacacgtctaggtgatgaagaa
catccttttggtcttgctgcgattatcgctaaccaagatgtagatggagtgaaagaaatg
tatgtcggtgaacaatacgcaggagagacgtttgctgattacatggggaattttgacaaa
agagtgaccattgacgaaaatggctgtgggaaatttttagtacgtggaaattctgtatct
gtatgggttaaggatgccgtaacaccggaagaagccttcgtggaagatgcagaagagagc
gaagaataa

DBGET integrated database retrieval system