KEGG   Jeotgalibacillus malaysiensis: JMA_01320Help
Entry
JMA_01320         CDS       T03570                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
jeo  Jeotgalibacillus malaysiensis
Brite
KEGG Orthology (KO) [BR:jeo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:jeo03012]
    JMA_01320
   03029 Mitochondrial biogenesis [BR:jeo03029]
    JMA_01320
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jeo04147]
    JMA_01320
Translation factors [BR:jeo03012]
 Eukaryotic Type
  Elongation factors
   JMA_01320
 Prokaryotic Type
   JMA_01320
Mitochondrial biogenesis [BR:jeo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    JMA_01320
Exosome [BR:jeo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   JMA_01320
  Exosomal proteins of breast cancer cells
   JMA_01320
  Exosomal proteins of colorectal cancer cells
   JMA_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AJD89449
UniProt: A0A0B5AN88
LinkDB All DBs
Position
143970..145160
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLHKKYGRGSAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREH
ILLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEIRDLLSEYDFPGDDIPVIKGSALKAL
EGEAEWEEKIFELMEAVDSYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLSEEPKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDINRGQVLAKPGT
ITPHTNFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVCNLPEGVEMVMPGDNIE
MTVELISPIAIEEGTKFSIREGGRTVGAGVVASIQK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaaattcgaccgttcgaaaacccatgcgaatattggaacaatcggacac
gttgaccatggtaaaacaactctaactgctgcaatcacaactgtacttcacaagaaatat
ggtcgtggatctgcaatggcatacgatcaaatcgatggtgctccagaagagcgcgagcgc
ggaatcacaatctcaactgcacacgttgagtacgaaactgacactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaagaacatgatcactggtgctgctcaaatg
gacggcggtattcttgtagtatctgctgctgatggcccaatgccacagactcgtgagcac
atccttctatctcgtcaggtaggtgtaccttaccttgttgtattcatgaacaagtgtgac
atggtagacgacgaagaactacttgaactagttgaaatggaaatccgtgaccttctttct
gagtacgatttccctggcgacgacattccagtaatcaaaggttctgcacttaaagctctt
gaaggagaagctgagtgggaagagaaaatcttcgaacttatggaagctgtagatagctac
attccaactcctgagcgtgacactgacaagccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggacgtgttgagcgtggacaagttaaagtt
ggtgacgaagtagaaatcatcggtctttctgaagagccgaagaaaactactgtaactggt
gttgaaatgttccgtaagcttcttgactatgcagaagctggcgacaacattggtgcactt
cttcgtggggtttctcgcgacgacatcaaccgtggacaggttcttgctaagccaggaaca
atcactccacacacaaacttcaaagctgaagtttatgttctatcaaaagaagaaggtgga
cgtcacactccattcttcactaactaccgcccacagttctacttccgtactacggacgta
actggcgtatgtaaccttcctgaaggagtagaaatggttatgcctggcgacaacatcgaa
atgactgttgagctaatctctcctatcgcaatcgaagaaggaactaagttctctattcgt
gaaggtggacgtacagtaggcgctggcgttgtagcttctatccagaagtaa

DBGET integrated database retrieval system