KEGG   Jeotgalibacillus malaysiensis: JMA_13890Help
Entry
JMA_13890         CDS       T03570                                 

Definition
(GenBank) hypothetical protein
Organism
jeo  Jeotgalibacillus malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Cyc-maltodext_C Glyco_hydro_66 Alph_Pro_TM
Motif
Other DBs
NCBI-ProteinID: AJD90706
UniProt: A0A0B5AKV3
LinkDB All DBs
Position
1278882..1280426
Genome map
AA seq 514 aa AA seqDB search
MRRVSALLLITILLFNSAFLNSAGAVEKEERMWQDESIYFLMVDRFLNGDTSNDFTVNTQ
DPLAYHGGDFQGVINELDHIKDMGFTAIWLTPVFSNEENGYHGYWIDDFYETEEHFGTIE
EFKTLVDEAHDRDIKVILDFVVNHTAPTHPWMSDPEKEDWYHEEQPIRDNNDPEQLENGW
IYGLPDLNTENPEVREYLFDAAKWWIEETDIDGYRLDTVKHVPAEFWTEFSSEVKSVKDD
FYLIGEVYDTDVRKIAEYADTGIDGFVDFPLAEQMRTAFQTVDQSTDRLFNYWDYNQQFF
DNPYLMGNFIDNHDMSRFTRLAAENNMFPGTRWELATVFMFTVPGIPIMYYGSEIALDGG
EDPDNRRLMDFNVDEELKDYISDVGELRQELPSLTRGTLNVLYNEQGMLVYEREYEDETS
VIAINNTSETQTVDLPVADFTEDSELRGLLGGDLVRPENDQFRIVLDREVAEIYVVAEET
GINYGFLALIAAVWVFFIGLFIFMKKKGNRKSKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagagtcagcgctcttttactcatcactatcctcctttttaatagcgcttttttg
aattcagcaggcgctgttgaaaaggaagagagaatgtggcaggacgaatcaatttatttt
ctaatggtggaccgttttctaaatggtgacacttcaaatgattttacagtgaatacgcag
gatccgcttgcgtatcacggtggtgacttccagggcgttatcaatgagctggatcacatt
aaggacatgggctttactgcaatctggctgacgccggtcttttctaatgaagaaaacggg
tatcacggctactggattgatgacttttatgaaacagaagagcattttggcacaattgaa
gaatttaagacgcttgtagatgaagcacatgacagagatatcaaagtcatcctggacttt
gttgtcaatcacacagcaccaacccacccgtggatgtcagatcctgaaaaagaagactgg
taccatgaagaacagccgatcagagacaataatgatcctgaacagcttgaaaacggctgg
atttatgggctgccggacctgaatactgaaaacccggaagtgcgggaatacttatttgac
gccgctaaatggtggatagaagaaactgatattgatggctaccgtcttgatacagttaag
cacgttccggctgagttctggactgagttttcatcagaagttaaatcagttaaagatgac
ttttacttaatcggtgaagtgtatgatacagatgtaagaaaaattgctgaatatgcagat
accggaattgacgggtttgttgactttccactggctgaacagatgagaacagcttttcag
acggttgatcaatctacagaccgcctgttcaactattgggattataatcagcagttcttt
gacaacccgtatctgatgggtaatttcattgataaccacgatatgtcgcgttttacaagg
cttgctgctgagaataatatgttcccgggtacaagatgggagcttgcgacagtctttatg
ttcacggttccggggattccaatcatgtattatggatctgagatcgcactcgatggcgga
gaagatcctgataaccggagactcatggactttaatgttgatgaagagctgaaggattat
atttcagatgtcggtgaactgagacaggagttgccatcgttaacgagagggactttaaat
gttctttataacgagcagggcatgcttgtatatgaacgtgaatatgaagatgaaaccagt
gtgatcgcaattaacaatacgagtgaaacacagacagttgatttacctgtagcagatttc
acagaagacagtgaactgcgcggactgcttggtggggaccttgtaagacctgagaacgat
cagttcagaattgtacttgatcgtgaagttgccgagatctatgtcgttgctgaagaaaca
ggtattaattatggatttttagcattaattgcggctgtctgggtattctttatcggatta
ttcatatttatgaagaaaaaagggaatagaaaatcaaaggcataa

DBGET integrated database retrieval system