KEGG   Jeotgalibaca sp. PTS2502: BW721_06180Help
Entry
BW721_06180       CDS       T04689                                 

Definition
(GenBank) hypothetical protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
jep02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:jep00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BW721_06180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jep02000]
    BW721_06180
   02035 Bacterial motility proteins [BR:jep02035]
    BW721_06180
Transporters [BR:jep02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    BW721_06180
Bacterial motility proteins [BR:jep02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BW721_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 OpuAC Lig_chan-Glu_bd NMT1 LPAM_2
Motif
Other DBs
NCBI-ProteinID: APZ50270
UniProt: A0A1U7EEU2
LinkDB All DBs
Position
1268196..1269092
Genome map
AA seq 298 aa AA seqDB search
MQRNKKALLSGFAALSALFLAACGNTDTGNSSNETANPDNTSTEKTAWDRIEESGVLKVA
TSGTLFPSSYHGDDNELTGYEVEVVKEVADRLGLEVDFMEMGVDGMLTAVQSGQVDAVAN
GFDITEARLEDYHFSDPYKYSFGGLVVRASDNSGIETMEDWDGKKAAGGATTVYMALAKQ
LGAEPVTYDNATNDVFFRDVASGRTDFIPNDYYVSNTAVQFYAELGVKMSDLYYNPSQQA
IVLSKDDTSVKEKIDPILAELAEEGVLTELSKEFFGGEDVSKELDNVDELPVIEIEQN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
attcaacgaaataaaaaagctttactaagcggtttcgcagcactttcagcattattttta
gccgcttgtggaaatacagatacaggaaacagctctaatgaaacagctaaccccgataac
actagtacagaaaagacggcttgggaccgaattgaagaatctggtgtcttaaaagttgct
acatctggtacgctatttccaagttcataccacggtgatgacaatgaactaactggttat
gaagttgaagtggttaaggaagtcgctgatcgtcttggtttggaagttgactttatggaa
atgggtgttgacggtatgttaacagctgttcaaagtggtcaagtagacgctgttgctaat
ggctttgatattactgaagcccgtttagaagactaccatttctctgatccttataaatac
tctttcggtggacttgtagttcgtgcttcagataactctggtatcgaaacaatggaagac
tgggacggcaaaaaagctgcaggtggtgcaacaaccgtttatatggcacttgcaaaacaa
ttaggcgctgagccagttacttatgataacgcaacaaatgatgtctttttccgtgatgtc
gcaagtggtcgtactgactttattccaaacgactattatgtttcaaacactgctgttcaa
ttttatgctgaattaggtgtaaaaatgtcagacttatattataatccaagtcaacaagcg
attgtgttgagtaaagatgacacatctgttaaagaaaaaattgaccctattttagctgaa
ttagctgaagaaggcgttctaactgaactttcaaaagaattcttcggtggtgaagacgtt
tcgaaagaattagacaacgttgatgaattgccagttattgaaatcgaacaaaattaa

DBGET integrated database retrieval system