KEGG   Jeotgalibaca sp. PTS2502: BW721_06745Help
Entry
BW721_06745       CDS       T04689                                 

Definition
(GenBank) DNA-binding response regulator
Organism
jep  Jeotgalibaca sp. PTS2502
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: APZ49401
UniProt: A0A1U7ECB8
LinkDB All DBs
Position
complement(1383331..1384044)
Genome map
AA seq 237 aa AA seqDB search
MNILMIEDNEAVCEMMDMFFEKEAWQPQFEGDGKQGLDVFLADQEKWDMIILDLNLPTMD
GMQVCQKIRSVSDHVPIIMLTARDSESDQVIGLEIGADEYVTKPFSPLTLMARIKALYRR
SKLANPVKEPENDSRFDITTNRVKISTSTREAFLDDISIESLTPKEFEIFALLASHPKQV
FSREHLLTSIWEDPYFGDERTIDAHIKKLRQKIEQVGPQLIQTVWGVGYKFDDTIIE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattaatgattgaagataatgaagcagtctgcgaaatgatggatatgtttttt
gaaaaggaagcttggcaaccccaatttgaaggtgatggcaagcaaggattagatgtattt
ctagcagaccaagaaaagtgggatatgattatccttgatttaaacttgccaacgatggat
ggcatgcaagtttgccaaaaaatcagatcagtatcagaccacgttcccattattatgctc
acagctcgtgattcggaaagtgatcaagtgatcggtttggaaatcggggcagatgagtac
gtaaccaaaccgttcagtcctttgactttaatggcaagaataaaagccctgtatcgccgc
tctaaattagctaacccggtcaaagaaccagagaatgacagtcggtttgatattacaaca
aatcgcgtaaaaattagtacatcaacgcgtgaagcctttcttgatgatattagtattgaa
agcttaacacctaaagaatttgaaatatttgctttattggctagccatcctaaacaagtt
ttctccagagagcacctattgaccagtatttgggaagacccctactttggagacgagcgt
acgattgatgctcacattaaaaagcttcgtcaaaaaattgaacaagtcggaccacaattg
attcaaacggtctggggagtcggctacaaattcgatgacaccataatcgaatag

DBGET integrated database retrieval system