KEGG   Jeongeupia sp. USM3: BJP62_00865Help
Entry
BJP62_00865       CDS       T04552                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00020  Citrate cycle (TCA cycle)
jeu00270  Cysteine and methionine metabolism
jeu00620  Pyruvate metabolism
jeu00630  Glyoxylate and dicarboxylate metabolism
jeu00680  Methane metabolism
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01120  Microbial metabolism in diverse environments
jeu01130  Biosynthesis of antibiotics
jeu01200  Carbon metabolism
Module
jeu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jeu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jeu_M00012  Glyoxylate cycle
jeu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP62_00865
   00620 Pyruvate metabolism
    BJP62_00865
   00630 Glyoxylate and dicarboxylate metabolism
    BJP62_00865
  09102 Energy metabolism
   00680 Methane metabolism
    BJP62_00865
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BJP62_00865
Enzymes [BR:jeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BJP62_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AOX99128
UniProt: A0A1D9BA06
LinkDB All DBs
Position
complement(181053..182033)
Genome map
AA seq 326 aa AA seqDB search
MKKPVRVAVTGAAGQIGYSLLFRIASGAMLGPDQPVILQLLDITPSLPALNGVVMELDDC
AFPLLQGIIQSDDPKVAFKDADIALLVGARPRGPGMERKDLLEANGAIFTTQGRALNEVA
SRDVKVLVVGNPANTNAYIAMKNAPDLNPANFTAMMRLDHNRALTQIGQKTGNAVTDVKK
MIIWGNHSATQYPDIFHAEVKGQNAASLINDQKWLESEFIPTVQQRGAAIIKARGLSSAA
SAANAAIDHIRNWVLGTPEGDWVTMGVPANGEYGYSDLIYGYPVTCKDGKYTIVEGLEIS
EFSRARMDATAKELSEERDAIKHLLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacccgtacgcgtcgccgttaccggcgcagccggccagatcggctacagcctg
ctgttccgcattgcttccggcgccatgctcggcccggaccagccggtcatcctgcaactg
ctggacatcacccccagcctgccggcgctgaacggcgtcgtcatggaactggacgactgc
gcattcccgttgctgcaaggcatcatccagagcgacgacccgaaggtcgccttcaaggat
gccgacatcgccctgctggtcggcgcccgtccgcgcggcccgggcatggaacgcaaggac
ctgctcgaagccaacggcgcaatcttcaccacccagggccgcgcgctgaacgaagtcgcc
agccgtgacgtcaaggtgctcgtggtcggcaacccggccaacaccaatgcctacatcgcc
atgaagaacgcgccggacctgaacccggccaacttcaccgcgatgatgcgtctggaccac
aaccgcgcactgacgcagatcggccagaagaccggcaacgccgtcaccgacgtcaagaag
atgatcatctggggcaaccactcggccacccagtacccggacatcttccacgccgaagtg
aagggccagaacgccgccagcctgatcaacgaccagaaatggctcgaaagcgagttcatc
ccgaccgtgcaacagcgcggcgccgccatcatcaaggcacgcggcctgtcgtcggccgct
tcggccgccaacgccgccatcgaccacatccgcaactgggtgctcggcacgccggaaggc
gactgggtcaccatgggcgttccggcgaacggcgaatacggttacagcgacctgatctac
ggctacccggtaacctgcaaggacggcaagtacaccatcgtcgaaggtctggaaatcagc
gaattcagccgcgcccgcatggatgcgaccgcgaaggagctgtcggaagagcgcgacgcg
atcaagcacctgctgggctga

DBGET integrated database retrieval system