KEGG   Jeongeupia sp. USM3: BJP62_00885Help
Entry
BJP62_00885       CDS       T04552                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00020  Citrate cycle (TCA cycle)
jeu00190  Oxidative phosphorylation
jeu00650  Butanoate metabolism
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01120  Microbial metabolism in diverse environments
jeu01130  Biosynthesis of antibiotics
jeu01200  Carbon metabolism
Module
jeu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jeu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jeu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP62_00885
   00650 Butanoate metabolism
    BJP62_00885
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJP62_00885
Enzymes [BR:jeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJP62_00885
    1.3.5.4  fumarate reductase (quinol)
     BJP62_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Pyr_redox_3 HI0933_like NAD_binding_7 NAD_binding_8 GMC_oxred_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AOX99132
UniProt: A0A1D9B9P2
LinkDB All DBs
Position
183861..185633
Genome map
AA seq 590 aa AA seqDB search
MSVPVRKFDAVIVGAGGAGLRAALQLSEAGLKTAVLSKVFPTRSHTVAAQGGVSASLGNS
EPDHWHWHMYDTVKGSDWLGDQDAIEFMCREAPNVVVELEHFGMPFDRNADGTIYQRPFG
GHMSNFGEKPVRRACAAADRTGHAMLHALYQRNVRANTQFFVEWMALDLVRDEQGNVQGV
VAMEMETSDVYVFQAKATLFATGGAGRIFASSTNAFINTGDGLGMAARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILRNSAGERFMERYAPNAKDLASRDVVSRAMVTEINEG
RGCGPNKDHVLLDITHLDPEVIKSKLPGIREISIKFANVDPIKAPIPVVPTCHYQMGGIP
TNYKGEVIVDEKPVTGFYAAGEVACASVHGANRLGTNSLLDLLVFGKSSGNSMIDYIKTA
PKDLPALAMADVERSLARVERLNQQSNGTQVNDARAAMQATMQKHCGVFRFKDMLAEGVA
KILEVEKLVKTIEIADKSKTFNTARLEALELENLIEVAKATMISADARTESRGAHVRDDA
EDTPERPNGRDDENWLKHTLWHRDGNQLKYKPVTMKPLSVDTIALKTRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttccggttcgtaaattcgatgcagtgatcgtcggcgccggcggtgccggtctg
cgcgcagcactgcagctgtccgaagccggcctgaagaccgccgtgctctccaaggtgttt
ccgacccgctcgcacacggtggcggcgcagggtggcgtgtcggcatcgctcggcaactcc
gagcccgaccactggcactggcacatgtacgacaccgtcaagggttccgactggctcggc
gaccaggatgcgatcgagttcatgtgccgcgaagcgccgaacgtcgtcgtcgagctcgag
cacttcggcatgccgttcgaccgcaacgccgacggcacgatctaccagcgtccgttcggc
ggccacatgagcaacttcggcgaaaagccggtccgccgcgcctgtgccgccgccgaccgt
accggccacgccatgctgcacgcgctgtaccagcgcaacgtgcgcgccaatacgcagttc
tttgtcgaatggatggcgctggacctcgttcgtgacgagcagggcaacgtccagggcgtc
gtcgccatggaaatggaaacgtcggacgtctacgtgttccaggccaaggcgacgctgttc
gccaccggcggcgccggccgcatcttcgcgtcgtcgaccaatgccttcatcaataccggt
gacggcctcggcatggcggcacgcgccggcattccgctcgaagacatggaattctggcag
ttccacccgaccggcgtcgccggtgccggcgtgctgatcaccgaaggcgtacgcggcgag
ggtggtatcctgcgcaactcggccggcgagcgcttcatggagcgttacgcgccgaacgcc
aaggatctggcgtcgcgcgacgtcgtatcgcgcgccatggtcaccgagatcaacgaaggt
cgcggttgcggtccgaacaaggaccacgtgctgctcgacatcacccacctggacccggaa
gtcatcaagtccaagctgccgggcatccgcgagatctcgatcaagttcgccaacgtcgac
ccgatcaaggcgccgattccggtcgtgccgacctgccactaccagatgggcggcattccg
accaactacaagggcgaggtgatcgtcgacgagaagccggtgaccggtttctacgccgcc
ggcgaagtcgcctgcgcgtcggtgcacggcgccaaccgcctcggcaccaactcgctgctc
gacctgctggtattcggcaagagctcgggcaactcgatgatcgactacatcaagaccgcg
ccgaaggatctgccggcgctggcgatggccgacgtcgaacgttcgctggcccgcgtcgag
cgtctgaaccagcagagcaacggtacgcaggtcaacgacgcccgtgccgcaatgcaggcc
accatgcagaaacactgcggcgtgttccgcttcaaggacatgcttgccgaaggcgtggcg
aagattctggaagtcgaaaagctggtcaagaccatcgagattgccgacaagtccaagacc
ttcaataccgcgcgcctcgaagcgctggagctcgagaacctgatcgaagtcgccaaggcg
acgatgatctcggccgatgcccgcaccgaatcgcgcggcgcccacgtccgcgacgacgcc
gaggacacgccggagcgcccgaacggccgtgacgacgaaaactggctcaagcacacgctg
tggcatcgcgacggcaaccagctcaagtacaagccggtgacgatgaagccgctgtcggtc
gatacgatcgccctgaagacccgctcctactga

DBGET integrated database retrieval system