KEGG   Jeongeupia sp. USM3: BJP62_00890Help
Entry
BJP62_00890       CDS       T04552                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00020  Citrate cycle (TCA cycle)
jeu00190  Oxidative phosphorylation
jeu00650  Butanoate metabolism
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01120  Microbial metabolism in diverse environments
jeu01130  Biosynthesis of antibiotics
jeu01200  Carbon metabolism
Module
jeu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jeu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jeu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP62_00890
   00650 Butanoate metabolism
    BJP62_00890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJP62_00890
Enzymes [BR:jeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJP62_00890
    1.3.5.4  fumarate reductase (quinol)
     BJP62_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AOX99133
UniProt: A0A1D9B9N7
LinkDB All DBs
Position
185647..186357
Genome map
AA seq 236 aa AA seqDB search
MTTRTVKFSIYRFDPEKDAKPYMKDYTVELDSTDRKLLDALVKLKVVDDAISFRRSCREG
VCGSDAMNINGKNGLACVTDIDTLKQPIQIRPLPGLPVVRDLIVDMTQFFKQYHSIKPYV
INDTPAPDRERLQSPEDREELNGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFI
ADTRDTATNERLDNLEDPYRLFRCHSIMNCVDVCPKELNPTKAIGKIKDLMVKRIA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgactacccgtaccgtcaaattcagcatctaccgcttcgatccggaaaaggacgcgaag
ccgtacatgaaggactacaccgtcgaactcgattcgaccgaccgcaagctgctcgacgcg
ctggtcaagctcaaggtcgtcgacgatgcgatctcgttccgccgctcgtgccgcgaaggc
gtctgcggctcggacgcgatgaacatcaacggcaagaacggcctggcctgcgtgaccgac
atcgacacgctcaagcagccgatccagatccgtccgctgccgggcctgccggtggtgcgc
gacctgatcgtcgacatgacgcagttcttcaagcagtaccactcgatcaagccgtacgtg
atcaacgacacgccggcgccggatcgcgagcgtctgcagtcgccggaagaccgcgaggag
ctgaacggcctgtacgagtgcatcctgtgcgcgtgctgctcgacgtcctgtccttcgttc
tggtggaacccggacaagttcgtcggcccggccggcctgctcgccgcctatcgcttcatt
gcggatacccgcgatacggcgaccaacgagcgtctggataatctggaagacccgtaccgg
ctgttccgctgccactcgatcatgaactgcgtcgacgtctgcccgaaggaactcaatccg
accaaggcgatcggcaagatcaaggatctgatggtcaagcgcatcgcctga

DBGET integrated database retrieval system