KEGG   Jeongeupia sp. USM3: BJP62_05355
Entry
BJP62_05355       CDS       T04552                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
jeu  Jeongeupia sp. USM3
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:jeu02044]
    BJP62_05355
Secretion system [BR:jeu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJP62_05355
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: AOX99936
UniProt: A0A1D9BBY0
LinkDB
Position
complement(1164274..1165752)
AA seq 492 aa
MQTELQSQGGAAVAEASSLLDTIIDQSRVATNEHEKGYTRDLIGELVEQVLAGTVTLSKD
LAASIDARIAEIDGVLSEQLNEIMHHESFQKLEASWRGLKYLIAESETSTQLKIKVLNVS
KKDLVKDFKASPEFDQSALFKKIYEEEYGTFGGAPYAGLVGDYEFGRHPEDFYLLDELSH
VAASAHAPLITAANPGLFGLETFADIGKPRDLAKIFDTVEYAKWKSFRESEDSRYVGMVL
PHVLGRMPYGRDTVPVEDFDFEENVDGTDHSKYLWTNAVYSYAARLTDAFAQFGWLAAIR
GVEGGGLVEGLPAHTFNTDDGEVALKCPTEVAITDRTEKVLSDLGFISLVHCKNTDYAAF
FSGQSVQKAKTYNTDSANANARLSTQLPYIFAVSRIAHYMKSIMRDKIGSFASRQNVQDF
LNTWLAQYVLLDDSASQEAKSKYPLREARVDVVEVPGKPGVYRAAAFLRPHFQLDELTIS
LRLVAELPKAAR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcaaactgaactgcaatcccagggcggcgcggccgtcgccgaagcgtcgagcctgctc
gacaccatcatcgaccagagccgggtcgcgaccaatgaacacgagaagggttacacgcgc
gatttgatcggcgaactcgtcgaacaggtgctcgccggtaccgtgaccctgtcgaaggat
ctggccgcgagcatcgacgcacgcatcgccgaaatcgacggcgtgctgtccgaacagctg
aacgagatcatgcaccacgagagcttccagaagctcgaagcatcgtggcgcggcctgaag
tacctgattgccgaatccgaaaccagcacccagctcaagatcaaggtgctgaacgtgtca
aagaaggacctggtcaaggacttcaaggcttcgccggagttcgaccagagtgcgctgttc
aagaagatctacgaagaggagtacggcaccttcggcggtgcgccgtacgccggcctggtc
ggtgactacgagttcggccgccatccggaagatttctacctgctcgacgagctgtcgcac
gttgccgcctcggcgcatgcgccgctgatcaccgccgcaaacccggggctgttcggcctg
gaaaccttcgccgacatcggcaagccgcgcgatctggccaagatcttcgatacggtcgaa
tacgccaagtggaaatcgttccgtgagtcggaagactcgcgttacgtcggcatggtgctg
ccgcatgtgctcggccgcatgccttatggccgtgacaccgtgccggtcgaggacttcgat
ttcgaagagaacgtcgacggcaccgaccacagcaagtacctgtggaccaacgcggtctac
agctacgccgcccggctgaccgatgccttcgcgcagttcggctggctggccgcgatccgc
ggtgtcgaaggcggtggtctggtcgaaggcctgccggcgcataccttcaataccgacgac
ggcgaagtggcgctgaagtgcccgaccgaagtcgcgatcaccgaccggaccgagaaggtg
ctgtccgacctcggcttcatttcgctggtccactgcaagaacaccgactacgcggcgttc
ttcagcggccagtcggtgcagaaggccaagacctacaacaccgattcggccaacgccaac
gcgcggctgtcgacgcagctgccgtacatcttcgccgtgtcgcggatcgcgcactacatg
aagtcgatcatgcgcgacaagatcggcagttttgcttcgcggcagaacgtgcaggacttc
ctcaatacctggctggcgcagtacgtgctgctcgacgattcggcttcgcaggaagccaag
tcgaagtatccgttgcgcgaagcccgcgtggatgtggtcgaggtgccgggcaagccgggc
gtgtatcgcgccgccgctttcctgcgcccgcacttccagctcgacgaactcacgatctcg
ctccgtctcgttgccgaactgcccaaagcagcgcgctga

DBGET integrated database retrieval system