KEGG   Jeongeupia sp. USM3: BJP62_09280Help
Entry
BJP62_09280       CDS       T04552                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01130  Biosynthesis of antibiotics
jeu01230  Biosynthesis of amino acids
Module
jeu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BJP62_09280
Enzymes [BR:jeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BJP62_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 ATP_bind_2 AAA_25 AAA_22 AAA_16 AAA_24 dNK TsaE CHDNT SRP54 AAA_5 AAA
Motif
Other DBs
NCBI-ProteinID: AOY00614
UniProt: A0A1D9BE77
LinkDB All DBs
Position
complement(1955303..1955839)
Genome map
AA seq 178 aa AA seqDB search
MPGMKLPGNFFLVGLMGAGKTTVGRTLARATDKTFYDSDHEITARSGARIPVIFELEGED
GFRKREAAVIAELTTLQGIVLATGGGAVLNPDNRDCLRRNGFVIYLRASVDDLFARTSHD
KNRPLLQTENPKQKLQELFEIRDPIYRELADLVIDTSNQTVQSLTQRLLRELEKKLNA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcatgaaactgccaggcaatttttttctggtcggcctgatgggcgccggcaaa
acgacggtggggcgcacgctggcgcgggcgaccgacaagacgttttacgattccgaccac
gagatcaccgcgcgcagcggtgcgcgcatcccggtgattttcgagctcgagggcgaggac
ggtttccgcaagcgcgaggcggcggtgatcgccgaactgaccaccttgcagggcatcgtg
ctcgcgaccggcggcggtgcggtactcaacccggacaaccgcgactgcctgcgccgcaac
ggttttgtcatctatctgcgcgccagcgtcgacgatctgttcgcgcgcacttcgcacgac
aagaaccggccgctgctgcagaccgaaaaccccaagcagaagctgcaggagctgttcgag
atccgcgatccgatctaccgcgagctcgccgacctcgtcatcgataccagcaaccagacc
gtccaatcgctgacgcagcgcctgctgcgcgaactggaaaaaaagctcaatgcgtaa

DBGET integrated database retrieval system