KEGG   Jeongeupia sp. USM3: BJP62_09310Help
Entry
BJP62_09310       CDS       T04552                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00550  Peptidoglycan biosynthesis
jeu01100  Metabolic pathways
jeu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP62_09310
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BJP62_09310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:jeu01003]
    BJP62_09310
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
    BJP62_09310
Enzymes [BR:jeu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BJP62_09310
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJP62_09310
Glycosyltransferases [BR:jeu01003]
 Polysaccharide
  Bacterial polysaccharide
   BJP62_09310
Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BJP62_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AOY00619
UniProt: A0A1D9BE62
LinkDB All DBs
Position
1960954..1963266
Genome map
AA seq 770 aa AA seqDB search
MTKRILLIALGALIGLVLVTAGLVFFAVVITYPRLPALNALTDYRPKIPLRVYTADRVLI
GEFGEERRAFTPIDQVPQLMKQALLAAEDERFYQHGGIDYIGVARAMVGNIVSGHSQSGA
STITMQVARNFYLSNEKTFTRKFNEALLSFKIEHNLSKDQILELYINQIYLGQRAYGFTT
AAQTYFGKDLKSLSIAQYAMLAGLPKAPSAYNPVVNPKRAALRQQYVLRRMHELRFITDQ
QYQEAQQAPLELRRGSLQYAVHAEYIAEMARQMMVERYKDDAYTQGFSVYTTLDSRQQND
GYQALREGLFGYDARHGYRGPEGFVDAALLASGDEEALDDALSDTSDYDELRAAVVLAAT
PQSVTVFLKGGEKLQIGGDGLAFVRSAISSKNTPAARIRPGAIVRVKQGPKGWQISQLPQ
VEGAFVAMDPQNGAIRSLVGGFDFNRSHFNHVTQAMRQPGSSFKPFIYSAALERGVTPAT
LINDAPLVINPEQVGGQKWEPQNDDGKYMGMMTVRNALTLSRNLVSIRILQSVGAQYAQQ
FLPRFGLNPKDHPAYLTMALGAGSVTPLQMAEGYSVFANTGYRVHSYFVDRIEDSRGRVL
AQTQPEVAGQNAKRTLDARNAFVMSSMLHDVIRYGTAARANKALGRPDLYGKTGTTNDMR
DAWFAGYQPNLVAITWVGFDQPKTLGRGEYGGRLALPIWINFMSKALRDVPVYDYPVPEG
IVTQTIDTSRGPQTEYFYNEYTQTNPELGLGGGDGGAAAQPIDEIKDLLF
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacgaattctgctgatcgccctcggcgccctaatcggtttggttctggtgacg
gccggccttgtcttttttgccgtggtgatcacctacccgcgactgccggcgctcaatgcg
ctgaccgactatcgcccgaaaatcccgctgcgggtttataccgcagatcgcgtgctcatt
ggcgaattcggcgaagagcgccgcgcgttcacgccgatcgaccaggtgccgcaactgatg
aaacaggccttgctggcggccgaggacgagcgcttttaccagcatggcggcatcgactac
atcggcgtcgcacgcgccatggtcggcaacatcgtgtccgggcactcgcagtcaggcgcc
agcacgatcacgatgcaggtcgcgcgcaacttctatctgtcgaacgagaaaactttcacc
cgcaaattcaacgaagccttgttgtcgttcaagatcgaacacaatctgtccaaagaccag
attctcgagctttacatcaatcagatttatctcggacagcgagcttacggcttcaccacg
gcggcccagacttatttcggcaaggatttgaaatcgctcagcatcgcccagtacgcgatg
ctcgccggactgcccaaggcgccgtcggcgtacaacccggtcgtcaacccgaaacgcgcg
gcgctgcgccagcagtatgtgttgcgcagaatgcacgaactgcgcttcatcaccgaccag
cagtaccaggaggcgcagcaggcgccgctcgaactccggcgcggcagcctgcagtacgcg
gtgcacgccgagtacattgccgagatggcccggcagatgatggtcgagcgctacaaggac
gatgcgtacacccagggcttttcggtctacacgacgctcgacagccggcagcagaacgac
ggctatcaggccttgcgcgaaggcctgttcggctacgacgcccgccacggctatcgcggc
ccggaaggtttcgtcgatgcggcactgctggccagcggcgacgaggaggcgctcgacgac
gcgctgtccgacacgtccgattacgacgaactgcgcgctgccgtggtgctcgcggcgacg
ccgcagtcggtcaccgttttcctcaagggcggcgaaaagctgcagatcggcggcgacggg
ctggccttcgtccgttcggcgatctcgagcaagaacaccccggcggcacggatccgcccc
ggtgcgatcgtccgcgtcaagcaagggccgaagggctggcagatcagccagttgccgcag
gtcgagggcgccttcgtcgcgatggacccgcagaacggcgcgatccgttcgctcgtcggc
ggcttcgacttcaatcgcagccacttcaaccatgtgacccaggcgatgcgccagccgggt
tcgagcttcaagcccttcatctattcggccgcgctcgagcgcggcgtgacgccggcgacg
ctgatcaacgatgcaccgctggtgatcaaccccgaacaggtcggcggccagaagtgggag
ccgcagaacgacgacggcaagtacatgggaatgatgacggtgcgcaatgcgctgacgctg
tcgcgcaacctcgtgtcgatccgcatcctgcaatcggtcggcgcccagtacgcgcagcag
ttcctgccgcgcttcggcctcaatccgaaggaccacccggcctacctgacgatggcgctc
ggcgccggcagcgtcacgccgctgcagatggccgagggttattcggtgttcgccaacacc
ggctaccgcgtgcattcgtacttcgtcgaccggatcgaggacagccgcggccgcgtgctg
gcacagacccagcccgaagtcgccggccagaacgccaagcgcacgctcgacgcgcgcaat
gccttcgtcatgagcagcatgctgcacgacgtgatccgctacggcaccgcggcacgcgcc
aacaaggcgctcggccggcccgacctgtacggcaagaccgggacgaccaacgacatgcgc
gacgcgtggttcgccggctaccagccgaacctggtcgcgatcacctgggtcggcttcgac
cagcccaagacgctcggccgcggcgagtacggcggccggctggcgctgccgatctggatc
aacttcatgagcaaggcgctgcgcgacgtgccggtgtacgattatccggtacccgagggc
atcgtcacccagacgatcgacaccagccgcggcccgcagaccgagtacttctacaacgag
tacacgcagaccaatccggaactcgggttgggcggtggagacggtggcgctgcagcccag
ccgatcgacgagatcaaggacctgctgttctaa

DBGET integrated database retrieval system